RDH16 Antibody


Western Blot: RDH16 Antibody [NBP1-87117] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining in human liver and kidney tissues using anti-RDH16 antibody. Corresponding RDH16 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

RDH16 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVT
Specificity of human RDH16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RDH16 Protein (NBP1-87117PEP)
Read Publication using NBP1-87117.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24648543)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RDH16 Antibody

  • EC 1.1
  • EC 1.1.1
  • EC
  • Microsomal NAD+-dependent retinol dehydrogenase 4
  • retinol dehydrogenase 16 (all-trans and 13-cis)
  • retinol dehydrogenase 16 (all-trans)
  • retinol dehydrogenase 16
  • RODH4
  • RODH-4
  • SDR9C8
  • short chain dehydrogenase/reductase family 9C, member 8
  • Sterol/retinol dehydrogenase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RDH16 Antibody (NBP1-87117)(1)

Reviews for RDH16 Antibody (NBP1-87117) (0)

There are no reviews for RDH16 Antibody (NBP1-87117). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RDH16 Antibody (NBP1-87117) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RDH16 Products

Bioinformatics Tool for RDH16 Antibody (NBP1-87117)

Discover related pathways, diseases and genes to RDH16 Antibody (NBP1-87117). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RDH16

There are no specific blogs for RDH16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RDH16 Antibody and receive a gift card or discount.


Gene Symbol RDH16