RDH16 Antibody - BSA Free

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Analysis in human liver and pancreas tissues. Corresponding RDH16 RNA-seq data are presented for the same tissues.

Western Blot: RDH16 Antibody [NBP1-87117] - Analysis in human liver tissue.

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human kidney shows no positivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human lymph node shows no positivity as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RDH16 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RDH16
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RDH16 Protein (NBP1-87117PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24648543)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RDH16 Antibody - BSA Free

• EC 1.1
• EC 1.1.1
• EC 1.1.1.105
• Microsomal NAD+-dependent retinol dehydrogenase 4
• retinol dehydrogenase 16 (all-trans and 13-cis)
• retinol dehydrogenase 16 (all-trans)
• retinol dehydrogenase 16
• RODH4
• RODH-4
• SDR9C8
• short chain dehydrogenase/reductase family 9C, member 8
• Sterol/retinol dehydrogenase

Background

Retinol dehydrogenase 16 (RDH16) is an oxidoreductase with a preference for NAD. It oxidizes all-trans-retinol and 13-cis-retinol to the corresponding aldehydes. RDH16 has higher activity towards CRBP-bound retinol than with free retinol. It oxidizes 3-alpha-hydroxysteroids and also oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. RDH16 can also catalyze the reverse reaction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RDH16 Antibody (NBP1-87117)(1)

Publication using NBP1-87117

• Kampf C, Mardinoglu A, Fagerberg L et al. The human liver-specific proteome defined by transcriptomics and antibody-based profiling. FASEB J 2014-07-01 [PMID: 24648543]

Bioinformatics

• Gene Symbol: RDH16
• Entrez:
  • 8608(Human)
• Uniprot:
  • O75452(Human)