![Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Analysis in human liver and pancreas tissues. Corresponding RDH16 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/RDH16-Antibody-Immunohistochemistry-Paraffin-NBP1-87117-img0015.jpg "Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Analysis in human liver and pancreas tissues. Corresponding RDH16 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RDH16 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunohistochemistry-Paraffin-NBP3-16627-img0001.jpg)
-Immunocytochemistry-Immunofluorescence-NBP3-16627-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-NBP3-16627-img0003.jpg)
-Flow-Cytometry-NBP2-02164-img0001.jpg)
-Flow-Cytometry-NBP2-02164-img0002.jpg)
-Flow-Cytometry-NBP2-02164-img0003.jpg)
-Flow-Cytometry-NBP2-00637-img0001.jpg)
-Flow-Cytometry-NBP2-00637-img0002.jpg)
-Western-Blot-NBP2-00637-img0003.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-50444-img0001.jpg)
-Western-Blot-NBP2-50444-img0002.jpg)
-Immunohistochemistry-NBP2-50444-img0004.jpg)
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
| Publication using NBP1-87117 | Applications | Species |
|---|---|---|
| Kampf C, Mardinoglu A, Fagerberg L et al. The human liver-specific proteome defined by transcriptomics and antibody-based profiling. FASEB J 2014-07-01 [PMID: 24648543] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: RDH16 Antibody [NBP1-87117] - Analysis in human liver tissue.](http://images.novusbio.com/fullsize2/RDH16-Antibody-Western-Blot-NBP1-87117-img0014.jpg "Western Blot: RDH16 Antibody [NBP1-87117] - Analysis in human liver tissue.")
![Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize2/RDH16-Antibody-Immunohistochemistry-Paraffin-NBP1-87117-img0019.jpg "Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize2/RDH16-Antibody-Immunohistochemistry-Paraffin-NBP1-87117-img0016.jpg "Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/RDH16-Antibody-Immunohistochemistry-Paraffin-NBP1-87117-img0017.jpg "Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human lymph node shows no positivity as expected.](http://images.novusbio.com/fullsize2/RDH16-Antibody-Immunohistochemistry-Paraffin-NBP1-87117-img0018.jpg "Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human lymph node shows no positivity as expected.")
-Immunocytochemistry-Immunofluorescence-H00010170-M05-img0001.jpg)
![Immunocytochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1-A1_AF5869_Immunocytochemistry_10308.jpg)
![Immunohistochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1-A1_AF5869_Immunohistochemistry_10638.jpg)
![Simple Western Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1A1_AF5869_Simple_Western_17067.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")