DHRS9 Antibody

Images

 
Western Blot: DHRS9 Antibody [NBP1-89379] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: DHRS9 Antibody [NBP1-89379] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: DHRS9 Antibody [NBP1-89379] - Staining of human kidney shows moderate cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DHRS9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHRS9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DHRS9 Protein (NBP1-89379PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DHRS9 Antibody

  • dehydrogenase/reductase (SDR family) member 9,3alpha-HSD
  • EC 1.1
  • EC 1.1.1
  • EC 1.1.1.105
  • member 4,3-alpha-HSD
  • NADP-dependent retinol dehydrogenase/reductase
  • RDH15
  • RDH-E2
  • RDHL3ALPHA-HSD
  • RDHTBE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001646-M03
Species: Hu
Applications: WB, ELISA
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB6529
Species: Hu
Applications: WB, Simple Western
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87117
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-44090
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB7450
Species: Hu
Applications: IHC
NBP1-31378
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-55418
Species: Hu
Applications: ICC/IF
NBP2-30446
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00008630-P01
Species: Hu
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89379
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DHRS9 Antibody (NBP1-89379) (0)

There are no publications for DHRS9 Antibody (NBP1-89379).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHRS9 Antibody (NBP1-89379) (0)

There are no reviews for DHRS9 Antibody (NBP1-89379). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DHRS9 Antibody (NBP1-89379) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DHRS9 Products

Bioinformatics Tool for DHRS9 Antibody (NBP1-89379)

Discover related pathways, diseases and genes to DHRS9 Antibody (NBP1-89379). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHRS9 Antibody (NBP1-89379)

Discover more about diseases related to DHRS9 Antibody (NBP1-89379).
 

Pathways for DHRS9 Antibody (NBP1-89379)

View related products by pathway.

PTMs for DHRS9 Antibody (NBP1-89379)

Learn more about PTMs related to DHRS9 Antibody (NBP1-89379).

Blogs on DHRS9

There are no specific blogs for DHRS9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHRS9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHRS9