MFNG Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit MFNG Antibody - BSA Free (NBP2-14234) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: TTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLAS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MFNG |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (88%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MFNG Antibody - BSA Free
Background
MFNG, also known as Beta-1,3-N-acetylglucosaminyltransferase manic fringe, has 2 isoforms, a 321 amino acid isoform that is 36 kDa and a 307 amino acid isoform that is 35 kDa, Golgi apparatus membrane subcellular location, participates in the elongation of O-linked ligands to activate Notch signaling and has fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity. Studies on this protein have shown a relationship with the following diseases and disorders: alagille syndrome, basal cell carcinoma, hepatitis b, psoriasis, hepatitis, and carcinoma. This protein has also been shown to have interactions with NOTCH2, JAG1, JAG2, DLL1, NOTCH1, ITGA3, LHX2, and NOTCH3 in Notch signaling pathway, Pre-NOTCH Expression and Processing, Pre-NOTCH Processing in Golgi, Signal Transduction, Delta-Notch Signaling Pathway, other types of O-glycan biosynthesis, and Development Notch Signaling Pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Ca, Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ChIP, ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Publications for MFNG Antibody (NBP2-14234) (0)
There are no publications for MFNG Antibody (NBP2-14234).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MFNG Antibody (NBP2-14234) (0)
There are no reviews for MFNG Antibody (NBP2-14234).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MFNG Antibody (NBP2-14234) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MFNG Products
Blogs on MFNG