MFNG Antibody

Images

 
Immunohistochemistry-Paraffin: MFNG Antibody [NBP2-14234] - Staining of human colon shows strong positivity in glandular cells and ganglion cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MFNG Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCS AEHSHPALSCKMAAEFDTFLAS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MFNG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MFNG Protein (NBP2-14234PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MFNG Antibody

  • beta-1,3-N-acetylglucosaminyltransferase manic fringe
  • EC 2.4.1.222
  • manic fringe (Drosophila) homolog
  • manic fringe homolog (Drosophila)
  • MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  • MFNG
  • O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-39097
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90946
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39097
Species: Hu
Applications: WB, IHC, IHC-P
AF3444
Species: Hu
Applications: WB
AF3970
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP2-13382
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19882
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF4079
Species: Hu
Applications: WB, ICC
NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-14234
Species: Hu
Applications: IHC, IHC-P

Publications for MFNG Antibody (NBP2-14234) (0)

There are no publications for MFNG Antibody (NBP2-14234).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MFNG Antibody (NBP2-14234) (0)

There are no reviews for MFNG Antibody (NBP2-14234). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MFNG Antibody (NBP2-14234) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MFNG Products

Bioinformatics Tool for MFNG Antibody (NBP2-14234)

Discover related pathways, diseases and genes to MFNG Antibody (NBP2-14234). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MFNG Antibody (NBP2-14234)

Discover more about diseases related to MFNG Antibody (NBP2-14234).
 

Pathways for MFNG Antibody (NBP2-14234)

View related products by pathway.

PTMs for MFNG Antibody (NBP2-14234)

Learn more about PTMs related to MFNG Antibody (NBP2-14234).

Blogs on MFNG

There are no specific blogs for MFNG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MFNG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MFNG
Entrez