MFF Antibody


Western Blot: MFF Antibody [NBP1-70638] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MFF Antibody Summary

Synthetic peptides corresponding to C2ORF33 The peptide sequence was selected from the C terminal of C2ORF33 (NP_064579). Peptide sequence VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against C2orf33 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
MFF Lysate (NBP2-65434)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MFF Antibody

  • mitochondrial fission factor


The exact function of C2orf33 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P, Flow (-), ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MFF Antibody (NBP1-70638) (0)

There are no publications for MFF Antibody (NBP1-70638).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MFF Antibody (NBP1-70638) (0)

There are no reviews for MFF Antibody (NBP1-70638). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MFF Antibody (NBP1-70638) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional MFF Products

Bioinformatics Tool for MFF Antibody (NBP1-70638)

Discover related pathways, diseases and genes to MFF Antibody (NBP1-70638). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MFF Antibody (NBP1-70638)

Discover more about diseases related to MFF Antibody (NBP1-70638).

Pathways for MFF Antibody (NBP1-70638)

View related products by pathway.

PTMs for MFF Antibody (NBP1-70638)

Learn more about PTMs related to MFF Antibody (NBP1-70638).

Blogs on MFF

There are no specific blogs for MFF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MFF Antibody and receive a gift card or discount.


Gene Symbol MFF