MFF Antibody

Images

 
Western Blot: MFF Antibody [NBP1-70638] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MFF Antibody Summary

Immunogen
Synthetic peptides corresponding to C2ORF33 The peptide sequence was selected from the C terminal of C2ORF33 (NP_064579). Peptide sequence VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MFF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against C2orf33 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MFF Antibody

  • mitochondrial fission factor

Background

The exact function of C2orf33 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-76652
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-02477
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-13913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-59480
Species: Hu
Applications: WB
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34081
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-55290
Species: Hu, Mu, Rt, Po, Ch
Applications: WB, Simple Western, IHC, IHC-P
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC-P, IP
NBP1-51841
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
MAB91871
Species: Hu
Applications: WB, IHC, IHC-P, Flow (-), ICC
NBP1-84430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MFF Antibody (NBP1-70638) (0)

There are no publications for MFF Antibody (NBP1-70638).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MFF Antibody (NBP1-70638) (0)

There are no reviews for MFF Antibody (NBP1-70638). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MFF Antibody (NBP1-70638) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MFF Products

Bioinformatics Tool for MFF Antibody (NBP1-70638)

Discover related pathways, diseases and genes to MFF Antibody (NBP1-70638). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MFF Antibody (NBP1-70638)

Discover more about diseases related to MFF Antibody (NBP1-70638).
 

Pathways for MFF Antibody (NBP1-70638)

View related products by pathway.

PTMs for MFF Antibody (NBP1-70638)

Learn more about PTMs related to MFF Antibody (NBP1-70638).

Blogs on MFF

There are no specific blogs for MFF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MFF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MFF
Entrez
Uniprot