Methyltransferase like 5 Antibody - BSA Free

Western Blot: Methyltransferase like 5 Antibody [NBP1-56640] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: HT1080 cell lysate METTL5 is supported by BioGPS gene expression data to be expressed in HT1080

Immunohistochemistry: Methyltransferase like 5 Antibody [NBP1-56640] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes and sinusoids Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Methyltransferase like 5 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to METTL5(methyltransferase like 5) The peptide sequence was selected from the N terminal of METTL5. Peptide sequence IAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: METTL5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Methyltransferase like 5 Antibody - BSA Free

• EC 2.1.1.-
• FLJ10459
• HSPC133
• methyltransferase like 5
• methyltransferase-like protein 5

Background

METTL5 is a probable methyltransferase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Methyltransferase like 5 Antibody (NBP1-56640)(3)

Publications using NBP1-56640

• Wang Z, Liu J, Yang Y Et al. Expression and prognostic potential of ribosome 18S RNA m6A methyltransferase METTL5 in gastric cancer Cancer cell international 2021-10-26 [PMID: 34702266] (IHC-P, Human)
• Garcia BCB, Horie M, Kojima S Et al. BUD23-TRMT112 interacts with the L protein of Borna disease virus and mediates the chromosomal tethering of viral ribonucleoproteins Microbiology and immunology 2021-07-29 [PMID: 34324219]
• Richard EM, Polla DL, Assir MZ et al. Bi-allelic Variants in METTL5 Cause Autosomal-Recessive Intellectual Disability and Microcephaly Am. J. Hum. Genet. 2019-09-17 [PMID: 31564433]

Bioinformatics

• Gene Symbol: METTL5
• Uniprot:
  • Q9NRN9(Human)