Methionyl tRNA synthetase Antibody

Images

 
Western Blot: Methionyl tRNA synthetase Antibody [NBP1-87730] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human cerebral cortex shows cytoplasmic positivity in subsets of neurons.
Immunocytochemistry/ Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse cerebellum shows cytoplasmic immunoreactivity in Purkinje cells.
Immunocytochemistry/ Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse olfactory bulb shows cytoplasmic positivity in mitral and external plexiform layer neurons.
Immunocytochemistry/ Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse visual cortex shows cytoplasmic and axonal staining in neurons.
Immunocytochemistry/ Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse cerebral peduncle shows cytoplasmic positivity in red nucleus neurons.
Immunocytochemistry/ Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse pons shows neuronal positivity in motor trigeminal nucleus.
Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Methionyl tRNA synthetase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MARS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Methionyl tRNA synthetase Protein (NBP1-87730PEP)
Publications
Read Publication using NBP1-87730.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24103465)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Methionyl tRNA synthetase Antibody

  • cytosolic methionyl-tRNA synthetase
  • EC 6.1.1.10
  • FLJ35667
  • methionine tRNA ligase 1, cytoplasmic
  • Methionine--tRNA ligase
  • methionyl-tRNA synthetase
  • methionyl-tRNA synthetase, cytoplasmic
  • MetRS
  • MRS
  • MTRNS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92106
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
MAB5657
Species: Hu
Applications: WB, IP, ICC
MAB4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15447
Species: Hu
Applications: WB
AF1936
Species: Hu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1408
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IP

Publications for Methionyl tRNA synthetase Antibody (NBP1-87730)(1)

Reviews for Methionyl tRNA synthetase Antibody (NBP1-87730) (0)

There are no reviews for Methionyl tRNA synthetase Antibody (NBP1-87730). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Methionyl tRNA synthetase Antibody (NBP1-87730) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Methionyl tRNA synthetase Products

Bioinformatics Tool for Methionyl tRNA synthetase Antibody (NBP1-87730)

Discover related pathways, diseases and genes to Methionyl tRNA synthetase Antibody (NBP1-87730). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Methionyl tRNA synthetase Antibody (NBP1-87730)

Discover more about diseases related to Methionyl tRNA synthetase Antibody (NBP1-87730).
 

Pathways for Methionyl tRNA synthetase Antibody (NBP1-87730)

View related products by pathway.

PTMs for Methionyl tRNA synthetase Antibody (NBP1-87730)

Learn more about PTMs related to Methionyl tRNA synthetase Antibody (NBP1-87730).

Blogs on Methionyl tRNA synthetase

There are no specific blogs for Methionyl tRNA synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Methionyl tRNA synthetase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MARS