Home » Methionyl tRNA synthetase » Methionyl tRNA synthetase Antibodies » Methionyl tRNA synthetase Antibody

Methionyl tRNA synthetase Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Genetic Strategies: Western Blot: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is ...read more
Immunocytochemistry/ Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human cerebral cortex shows cytoplasmic positivity in subsets of neurons.
Western Blot: Methionyl tRNA synthetase Antibody [NBP1-87730] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse cerebellum shows cytoplasmic immunoreactivity in Purkinje cells.
Immunocytochemistry/ Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse olfactory bulb shows cytoplasmic positivity in mitral and external plexiform layer neurons.
Immunocytochemistry/ Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse visual cortex shows cytoplasmic and axonal staining in neurons.
Immunocytochemistry/ Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse cerebral peduncle shows cytoplasmic positivity in red nucleus neurons.
Immunocytochemistry/ Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse pons shows neuronal positivity in motor trigeminal nucleus.
Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

Methionyl tRNA synthetase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFD
Specificity
Specificity of human, mouse Methionyl tRNA synthetase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MARS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Methionyl tRNA synthetase Protein (NBP1-87730PEP)
Publications
Read Publication using NBP1-87730.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24103465)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Methionyl tRNA synthetase Antibody

  • cytosolic methionyl-tRNA synthetase
  • EC 6.1.1.10
  • FLJ35667
  • methionine tRNA ligase 1, cytoplasmic
  • Methionine--tRNA ligase
  • methionyl-tRNA synthetase
  • methionyl-tRNA synthetase, cytoplasmic
  • MetRS
  • MRS
  • MTRNS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Methionyl tRNA
synthetase 2 Antibody
NBP1-92106
Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments & aggresome.
Immunohistochemistry-Paraffin: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
(39 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
CD55/DAF Antibody
NBP1-85467
Western Blot: CD55/DAF Antibody [NBP1-85467] - Analysis in human cell line HeLa.
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85467] - Immunohistochemistry analysis in human lung and pancreas tissues using NBP1-85467 antibody. Corresponding CD55 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85467] - Staining of human lung shows high expression.
Species: Hu
Applications: WB, IHC, IHC-P
Calretinin Antibody
NBP1-32244
Western Blot: Calretinin Antibody [NBP1-32244] - Sample (30 ug of whole cell lysate) A: A431 12% SDS PAGE Calretinin antibody, antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Calretinin Antibody [NBP1-32244] - U87-MG cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calretinin protein stained by Calretinin antibody diluted at 1:200. Blue: Hoechst 33342 staining.
Immunohistochemistry-Frozen: Calretinin Antibody [NBP1-32244] - Frozen Section adult mouse hippocampus. Green: Calretinin protein stained by Calretinin antibody diluted at 1:250. Red: NF-H, stained by NF-H antibody [114] diluted at 1:500. Blue: Fluoroshield with DAPI.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
CD21 Antibody
(SC0681)
NBP2-67605
Western Blot: CD21 Antibody (SC0681) [NBP2-67605] - Analysis of CD21 on different lysates using anti-CD21 antibody at 1/1,000 dilution. Positive control: Lane 1: Daudi Lane 2: Raji
Immunocytochemistry/Immunofluorescence: CD21 Antibody (SC0681) [NBP2-67605] - Staining CD21 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: CD21 Antibody (SC0681) [NBP2-67605] - Analysis of paraffin-embedded human tonsil tissue using anti-CD21 antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
DHRS4 Antibody
NBP1-83790
Western Blot: DHRS4 Antibody [NBP1-83790] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: DHRS4 Antibody [NBP1-83790] - Staining of human cell line A-431 shows positivity in nuclear membrane and vesicles.
Immunohistochemistry-Paraffin: DHRS4 Antibody [NBP1-83790] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CRIPTO Antibody
NB100-1598
Western Blot: CRIPTO Antibody [NB100-1598] - Total protein from human HeLa, NTERA-2 and spleen and embryonic mouse V6.5 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-Cripto in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: CRIPTO Antibody [NB100-1598] - CRIPTO antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Flow Cytometry: CRIPTO Antibody [NB100-1598] - An intracellular stain was performed on Jurkat with CRIPTO Antibody NB100-1598 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (SA5-10033, Thermo Fisher).
(2 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
Caspase-1 Antibody
(14F468)
NB100-56565
Western Blot: Caspase-1 Antibody (14F468) [NB100-56565] - Analysis of Caspase-1 using a Caspase-1 monoclonal antibody. Human HeLa (A) and mouse NIH3T3 lysate probed with Caspase-1 antibody at 0.5 ug/ml and 2 ug/ml, respectively.
Immunohistochemistry-Paraffin: Caspase-1 Antibody (14F468) [NB100-56565] - Tissue section of human intestine using Caspase-1 antibody (clone 14F468) at 5ug/ml concentration (1:200 dilution). The primary antibody binding to Caspase 1 in cells was detected using HRP conjugated anti-Mouse secondary antibody with DAB reagent, and the sections were further counterstained with hematoxylin for labeling cellular nuclei. This Caspase 1 antibody generated a diffused but specific cytoplasmic staining in columnar epithelia cells of villi, and a few cells depicted nuclear staining also. Only a subset of connective tissue cells in lamina propria depicted positivity (cytoplasmic) for this protein.
Immunohistochemistry-Paraffin: Caspase-1 Antibody (14F468) [NB100-56565] - Adenocarcinoma of the rectum stained with Caspase-1 antibody (5 ug/ml), peroxidase-conjugate and DAB chromogen. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
(26 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
CES2 Antibody
NBP1-84556
Western Blot: CES2 Antibody [NBP1-84556] - Analysis in human small intestine tissue.
Immunocytochemistry/Immunofluorescence: CES2 Antibody [NBP1-84556] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: CES2 Antibody [NBP1-84556] - Staining in human small intestine and pancreas tissues using anti-CES2 antibody. Corresponding CES2 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NTAL Antibody
[Unconjugated]
AF4066
Western blot shows lysates of THP‑1 human acute monocytic leukemia cell line, Ramos human Burkitt's lymphoma cell line and Raji human Burkitt's lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human NTAL Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4066) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for NTAL at approximately 25 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
THP‑1 human acute monocytic leukemia cell line was stained with Sheep Anti-Human NTAL Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF4066, filled histogram) or isotype control antibody (Catalog # 5-001-A, open histogram), followed by NorthernLights™ 637-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # NL011). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-57642
Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-57642] - Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Species: Hu
Applications: WB, IHC, IHC-P
ACAT1 Antibody
NBP1-89284
Western Blot: ACAT1 Antibody [NBP1-89284] - ACAT1 porcine cerebral cortex. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: ACAT1 Antibody [NBP1-89284] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
(1 Review)
(5 Publications)
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Serpin A1/alpha
1-Antitrypsin Antibod ...
NBP2-52557
Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody (5D1D2) [NBP2-52557] - Analysis using SERPINA1 mAb against HEK293 (1) and SERPINA1 (AA: 23-237)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: Serpin A1/alpha 1-Antitrypsin Antibody (5D1D2) [NBP2-52557] - Immunofluorescence analysis of GC-7901 cells using SERPINA1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody (5D1D2) [NBP2-52557] - Analysis of paraffin-embedded bladder cancer tissues using SERPINA1 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 12% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GSTP1 protein stained by GSTP1 antibody diluted at 1:500. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody diluted at 1:1000. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - Analysis of paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Arginine
decarboxylase Antibod
NBP2-15447
Western Blot: Arginine decarboxylase Antibody [NBP2-15447] - A. 30 ug human normal cerebellar lysate/extract10 % SDS-PAGE ADC antibody dilution: 1:1500
Western Blot: Arginine decarboxylase Antibody [NBP2-15447] - Sample (30 ug of whole cell lysate) A: U87-MG 10% SDS PAGE gel, diluted at 1:5000.
Western Blot: Arginine decarboxylase Antibody [NBP2-15447] - A. 30 ug SK-N-SH whole cell lysate/extract 10 % SDS-PAGE ADC antibody dilution: 1:5000
Species: Hu
Applications: WB
Complement
Component C2b Antibod ...
MAB1936
Complement Component C2b Antibody (269716)
(1 Publication)
Species: Hu
Applications: WB, IP
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(21 Reviews)
(525 Publications)
Species: Hu
PAR1/Thrombin
Receptor Antibody (N2
NBP1-71770
Western Blot: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of Thrombin Receptor expression in human testis using NBP1-71770.
Immunocytochemistry/Immunofluorescence: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Thrombin Receptor antibody was tested in HeLa cells with FITC (green). Nuclei and actin were counterstained with Dapi (blue) and Phalloidin (red).
Immunohistochemistry: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of Thrombin Receptor on mouse skin using NBP1-71770.
(3 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Cystatin B/Stefin
B Antibody [Unconjuga ...
AF1408
Western blot shows lysates of human colon tissue, PC‑12 rat adrenal pheochromocytoma cell line, A549 human lung carcinoma cell line, and SK‑BR‑3 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Rat Cystatin B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1408) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Cystatin B at approximately 11 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of A549 human lung carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Cystatin B at approximately 18 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Rat Cystatin B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1408) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Publication)
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IP

Publications for Methionyl tRNA synthetase Antibody (NBP1-87730)(1)


Reviews for Methionyl tRNA synthetase Antibody (NBP1-87730) (0)

There are no reviews for Methionyl tRNA synthetase Antibody (NBP1-87730). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Methionyl tRNA synthetase Antibody (NBP1-87730) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Methionyl tRNA synthetase Antibody (NBP1-87730)

Discover related pathways, diseases and genes to Methionyl tRNA synthetase Antibody (NBP1-87730). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Methionyl tRNA synthetase Antibody (NBP1-87730)

Discover more about diseases related to Methionyl tRNA synthetase Antibody (NBP1-87730).
 

Pathways for Methionyl tRNA synthetase Antibody (NBP1-87730)

View related products by pathway.

PTMs for Methionyl tRNA synthetase Antibody (NBP1-87730)

Learn more about PTMs related to Methionyl tRNA synthetase Antibody (NBP1-87730).

Blogs on Methionyl tRNA synthetase

There are no specific blogs for Methionyl tRNA synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Methionyl tRNA synthetase Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MARS