![Western Blot: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Western-Blot-NBP1-87730-img0014.jpg "Western Blot: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
Genetic Strategies
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFD |
| Specificity | Specificity of human, mouse Methionyl tRNA synthetase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MARS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-87730 | Applications | Species |
|---|---|---|
| van Meel E, Wegner DJ, Cliften P et al. Rare recessive loss-of-function methionyl-tRNA synthetase mutations presenting as a multi-organ phenotype. BMC Med Genet 2013 Oct 8 [PMID: 24103465] |
Secondary Antibodies |
Isotype Controls |
PTMs for Methionyl tRNA synthetase Antibody (NBP1-87730)Learn more about PTMs related to Methionyl tRNA synthetase Antibody (NBP1-87730).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MARS |
![Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87730-img0012.jpg "Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.")
![Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human cerebral cortex shows cytoplasmic positivity in subsets of neurons.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-87730-img0007.jpg "Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human cerebral cortex shows cytoplasmic positivity in subsets of neurons.")
![Western Blot: Methionyl tRNA synthetase Antibody [NBP1-87730] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Western-Blot-NBP1-87730-img0005.jpg "Western Blot: Methionyl tRNA synthetase Antibody [NBP1-87730] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp")
![Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse cerebellum shows cytoplasmic immunoreactivity in Purkinje cells.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87730-img0006.jpg "Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse cerebellum shows cytoplasmic immunoreactivity in Purkinje cells.")
![Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse olfactory bulb shows cytoplasmic positivity in mitral and external plexiform layer neurons.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87730-img0008.jpg "Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse olfactory bulb shows cytoplasmic positivity in mitral and external plexiform layer neurons.")
![Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse visual cortex shows cytoplasmic and axonal staining in neurons.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87730-img0009.jpg "Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse visual cortex shows cytoplasmic and axonal staining in neurons.")
![Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse cerebral peduncle shows cytoplasmic positivity in red nucleus neurons.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87730-img0010.jpg "Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse cerebral peduncle shows cytoplasmic positivity in red nucleus neurons.")
![Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse pons shows neuronal positivity in motor trigeminal nucleus.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87730-img0011.jpg "Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse pons shows neuronal positivity in motor trigeminal nucleus.")
![Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-87730-img0004.jpg "Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.")
![Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments & aggresome.](http://images.novusbio.com/fullsize2/Methionyl tRNA synthetase 2 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92106-img0007.jpg)
![Immunohistochemistry-Paraffin: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92106-img0002.jpg)
![Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.](http://images.novusbio.com/fullsize2/Albumin-Antibody-Western-Blot-NB600-41532-img0002.jpg)
![Western Blot: Calretinin Antibody [NBP1-32244] - Rat tissue extract (50 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with Calretinin antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/fullsize2/Calretinin-Antibody-Western-Blot-NBP1-32244-img0015.jpg)
![Immunocytochemistry/Immunofluorescence: Calretinin Antibody [NBP1-32244] - U87-MG cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calretinin protein stained by Calretinin antibody diluted at 1:200. Blue: Hoechst 33342 staining.](http://images.novusbio.com/fullsize2/Calretinin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-32244-img0010.jpg)
![Immunohistochemistry-Frozen: Calretinin Antibody [NBP1-32244] - Frozen Section adult mouse hippocampus. Green: Calretinin protein stained by Calretinin antibody diluted at 1:250. Red: NF-H, stained by NF-H antibody [114] (GTX634289) diluted at 1:500. Blue: Fluoroshield with DAPI.](http://images.novusbio.com/fullsize2/Calretinin-Antibody-Immunohistochemistry-Frozen-NBP1-32244-img0017.jpg)
![Western Blot: CD21 Antibody (SC0681) [NBP2-67605] - Analysis of CD21 on different lysates using anti-CD21 antibody at 1/1,000 dilution. Positive control: Lane 1: Daudi Lane 2: Raji](http://images.novusbio.com/fullsize2/CD21 Antibody (SC0681)-Western Blot-NBP2-67605-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: CD21 Antibody (SC0681) [NBP2-67605] - Staining CD21 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/fullsize2/CD21-Antibody-(SC0681)-Immunocytochemistry-Immunofluorescence-NBP2-67605-img0002.jpg)
![Immunohistochemistry-Paraffin: CD21 Antibody (SC0681) [NBP2-67605] - Analysis of paraffin-embedded human tonsil tissue using anti-CD21 antibody. Counter stained with hematoxylin.](http://images.novusbio.com/fullsize2/CD21-Antibody-(SC0681)-Immunohistochemistry-Paraffin-NBP2-67605-img0005.jpg)
![Western Blot: DHRS4 Antibody [NBP1-83790] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/DHRS4 Antibody-Western Blot-NBP1-83790-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: DHRS4 Antibody [NBP1-83790] - Staining of human cell line A-431 shows positivity in nuclear membrane and vesicles.](http://images.novusbio.com/fullsize/DHRS4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83790-img0003.jpg)
![Immunohistochemistry-Paraffin: DHRS4 Antibody [NBP1-83790] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.](http://images.novusbio.com/fullsize2/DHRS4-Antibody-Immunohistochemistry-Paraffin-NBP1-83790-img0001.jpg)
![Western Blot: CRIPTO Antibody [NB100-1598] - Analysis of Cripto in Dicer knockout mouse embryonic stem cell lysate.](http://images.novusbio.com/fullsize2/CRIPTO-Antibody-Western-Blot-NB100-1598-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: CRIPTO Antibody [NB100-1598] - CRIPTO antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).](http://images.novusbio.com/fullsize2/CRIPTO-Antibody-Immunocytochemistry-Immunofluorescence-NB100-1598-img0010.jpg)
![Flow Cytometry: CRIPTO Antibody [NB100-1598] - An intracellular stain was performed on HeLa cells with CRIPTO Antibody NB100-1598PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to phycoerythrin](http://images.novusbio.com/fullsize2/CRIPTO-Antibody-Flow-Cytometry-NB100-1598-img0011.jpg)
![Western Blot: Caspase-1 Antibody (14F468) [NB100-56565] - Analysis of Caspase-1 using a Caspase-1 monoclonal antibody. Human HeLa (A) and mouse NIH3T3 lysate probed with Caspase-1 antibody at 0.5 ug/ml and 2 ug/ml, respectively.](http://images.novusbio.com/fullsize2/Caspase-1-Antibody-(14F468)-Western-Blot-NB100-56565-img0003.jpg)
![Immunohistochemistry-Paraffin: Caspase-1 Antibody (14F468) [NB100-56565] - IHC analysis of a formalin fixed paraffin embedded (FFPE) tissue section of human intestine using Caspase-1 antibody (clone 14F468) at 5ug/ml concentration (1:200 dilution). The primary antibody binding to Caspase 1 in cells was detected using HRP conjugated anti-Mouse secondary antibody with DAB reagent, and the sections were further counterstained with hematoxylin for labeling cellular nuclei. This Caspase 1 antibody generated a diffused but specific cytoplasmic staining in columnar epithelia cells of villi, and a few cells depicted nuclear staining also. Only a subset of connective tissue cells in lamina propria depicted positivity (cytoplasmic) for this protein.](http://images.novusbio.com/fullsize2/Caspase-1-Antibody-(14F468)-Immunohistochemistry-Paraffin-NB100-56565-img0014.jpg)
![Immunohistochemistry-Paraffin: Caspase-1 Antibody (14F468) [NB100-56565] - Formalin-fixed, paraffin-embedded adenocarcinoma of the rectum stained with Caspase-1 antibody (5 ug/ml), peroxidase-conjugate and DAB chromogen. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.](http://images.novusbio.com/fullsize2/Caspase-1-Antibody-(14F468)-Immunohistochemistry-Paraffin-NB100-56565-img0005.jpg)
![Western Blot: CES2 Antibody [NBP1-84556] - Analysis in human small intestine tissue.](http://images.novusbio.com/fullsize2/CES2-Antibody-Western-Blot-NBP1-84556-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: CES2 Antibody [NBP1-84556] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.](http://images.novusbio.com/fullsize2/CES2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84556-img0008.jpg)
![Immunohistochemistry-Paraffin: CES2 Antibody [NBP1-84556] - Staining in human small intestine and pancreas tissues using anti-CES2 antibody. Corresponding CES2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/CES2-Antibody-Immunohistochemistry-Paraffin-NBP1-84556-img0011.jpg)
![Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-56762] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/fullsize2/Adenine Nucleotide Translocator 2 Antibody-Western Blot-NBP2-56762-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Adenine Nucleotide Translocator 2 Antibody [NBP2-56762] - Staining of human cell line PC-3 shows localization to mitochondria.](http://images.novusbio.com/fullsize2/Adenine-Nucleotide-Translocator-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56762-img0001.jpg)
![Western Blot: ACAT1 Antibody [NBP1-89284] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize2/ACAT1-Antibody-Western-Blot-NBP1-89284-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: ACAT1 Antibody [NBP1-89284] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://images.novusbio.com/fullsize2/ACAT1 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89284-img0007.jpg)
![Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/ACAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-89284-img0001.jpg)
![Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody (5D1D2) [NBP2-52557] - Analysis using SERPINA1 mAb against HEK293 (1) and SERPINA1 (AA: 23-237)-hIgGFc transfected HEK293 (2) cell lysate.](http://images.novusbio.com/fullsize2/Serpin-A1-alpha-1-Antitrypsin-Antibody-(5D1D2)-Western-Blot-NBP2-52557-img0012.jpg)
![Immunocytochemistry/Immunofluorescence: Serpin A1/alpha 1-Antitrypsin Antibody (5D1D2) [NBP2-52557] - Analysis of HepG2 cells using SERPINA1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.](http://images.novusbio.com/fullsize2/Serpin-A1-alpha-1-Antitrypsin-Antibody-(5D1D2)-Immunocytochemistry-Immunofluorescence-NBP2-52557-img0006.jpg)
![Immunohistochemistry-Paraffin: Serpin A1/alpha 1-Antitrypsin Antibody (5D1D2) [NBP2-52557] - Analysis of paraffin-embedded bladder cancer tissues using SERPINA1 mouse mAb with DAB staining.](http://images.novusbio.com/fullsize2/Serpin-A1-alpha-1-Antitrypsin-Antibody-(5D1D2)-Immunohistochemistry-Paraffin-NBP2-52557-img0009.jpg)
![Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 12% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Western-Blot-NBP2-16756-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GSTP1 protein stained by GSTP1 antibody diluted at 1:500. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody diluted at 1:1000. Blue: Hoechst 33342 staining.](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-16756-img0006.jpg)
![Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - Analysis of paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Immunohistochemistry-Paraffin-NBP2-16756-img0014.jpg)
![Western Blot: Arginine decarboxylase Antibody [NBP2-15447] - A. 30 ug human normal cerebellar lysate/extract10 % SDS-PAGE ADC antibody dilution: 1:1500](http://images.novusbio.com/fullsize2/Arginine-decarboxylase-Antibody-Western-Blot-NBP2-15447-img0008.jpg)
![Western Blot: Arginine decarboxylase Antibody [NBP2-15447] - Sample (30 ug of whole cell lysate) A: U87-MG 10% SDS PAGE gel, diluted at 1:5000.](http://images.novusbio.com/fullsize2/Arginine decarboxylase Antibody-Western Blot-NBP2-15447-img0001.jpg)
![Western Blot: Arginine decarboxylase Antibody [NBP2-15447] - A. 30 ug SK-N-SH whole cell lysate/extract 10 % SDS-PAGE ADC antibody dilution: 1:5000](http://images.novusbio.com/fullsize2/Arginine-decarboxylase-Antibody-Western-Blot-NBP2-15447-img0006.jpg)
![Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)](http://images.novusbio.com/fullsize2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-Paraffin-NBP2-34260-img0002.jpg)
![SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]](http://images.novusbio.com/fullsize2/Insulin Antibody (E2-E3 (same as INS04))-SDS-Page-NBP2-34260-img0003.jpg)
![Western Blot: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of Thrombin Receptor expression in human testis using NBP1-71770.](http://images.novusbio.com/fullsize2/PAR1-Thrombin-Receptor-Antibody-(N2-11)-Western-Blot-NBP1-71770-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Thrombin Receptor antibody was tested in HeLa cells with FITC (green). Nuclei and actin were counterstained with Dapi (blue) and Phalloidin (red).](http://images.novusbio.com/fullsize2/PAR1-Thrombin-Receptor-Antibody-(N2-11)-Immunocytochemistry-Immunofluorescence-NBP1-71770-img0011.jpg)
![Immunohistochemistry: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of Thrombin Receptor on mouse skin using NBP1-71770.](http://images.novusbio.com/fullsize2/PAR1-Thrombin-Receptor-Antibody-(N2-11)-Immunohistochemistry-NBP1-71770-img0012.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")