Methionyl tRNA synthetase Antibody - BSA Free

Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in human testis and skeletal muscle tissues using NBP1-87730 antibody. Corresponding Methionyl tRNA synthetase RNA-seq data are presented for the same tissues.

Western Blot: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MARS antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human testis shows strong membranous and cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human fallopian tube shows weak to moderated membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human stomach shows moderate membranous and cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Methionyl tRNA synthetase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Methionyl tRNA synthetase Antibody - BSA Free (NBP1-87730) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Methionyl tRNA synthetase Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFD
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MARS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Methionyl tRNA synthetase Protein (NBP1-87730PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Methionyl tRNA synthetase Antibody - BSA Free

• cytosolic methionyl-tRNA synthetase
• EC 6.1.1.10
• FLJ35667
• methionine tRNA ligase 1, cytoplasmic
• Methionine--tRNA ligase
• methionyl-tRNA synthetase
• methionyl-tRNA synthetase, cytoplasmic
• MetRS
• MRS
• MTRNS

Background

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene belongs to the class I family of tRNA synthetases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Methionyl tRNA synthetase Antibody (NBP1-87730)(1)

Publication using NBP1-87730

• van Meel E, Wegner DJ, Cliften P et al. Rare recessive loss-of-function methionyl-tRNA synthetase mutations presenting as a multi-organ phenotype. BMC Med Genet 2013-10-08 [PMID: 24103465]

Bioinformatics

• Gene Symbol: MARS1