![Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in human testis and skeletal muscle tissues using NBP1-87730 antibody. Corresponding Methionyl tRNA synthetase RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-87730-img0016.jpg "Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in human testis and skeletal muscle tissues using NBP1-87730 antibody. Corresponding Methionyl tRNA synthetase RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFD |
| Specificity | Specificity of human Methionyl tRNA synthetase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MARS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![NTAL Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "NTAL Antibody [Unconjugated]")
| Publication using NBP1-87730 | Applications | Species |
|---|---|---|
| van Meel E, Wegner DJ, Cliften P et al. Rare recessive loss-of-function methionyl-tRNA synthetase mutations presenting as a multi-organ phenotype. BMC Med Genet 2013 Oct 8 [PMID: 24103465] |
Secondary Antibodies |
Isotype Controls |
PTMs for Methionyl tRNA synthetase Antibody (NBP1-87730)Learn more about PTMs related to Methionyl tRNA synthetase Antibody (NBP1-87730).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MARS |
![Western Blot: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MARS antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Western-Blot-NBP1-87730-img0015.jpg "Western Blot: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MARS antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87730-img0012.jpg "Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human testis shows strong membranous and cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-87730-img0020.jpg "Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human testis shows strong membranous and cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-87730-img0017.jpg "Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human fallopian tube shows weak to moderated membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-87730-img0018.jpg "Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human fallopian tube shows weak to moderated membranous and cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human stomach shows moderate membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Methionyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-87730-img0019.jpg "Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human stomach shows moderate membranous and cytoplasmic positivity in glandular cells.")
![Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments & aggresome.](http://images.novusbio.com/images2/Methionyl tRNA synthetase 2 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92106-img0007.jpg)
![Immunohistochemistry-Paraffin: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.](http://images.novusbio.com/images2/Methionyl-tRNA-synthetase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92106-img0002.jpg)
![Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.](http://images.novusbio.com/images2/Albumin-Antibody-Western-Blot-NB600-41532-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Albumin-Antibody-Immunocytochemistry-Immunofluorescence-NB600-41532-img0003.jpg)
![Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining in human lung and kidney tissues using anti-CD55 antibody. Corresponding CD55 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/CD55-DAF-Antibody-Immunohistochemistry-Paraffin-NBP1-85466-img0007.jpg)
![Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human kidney shows low expression as expected.](http://images.novusbio.com/images2/CD55-DAF-Antibody-Immunohistochemistry-Paraffin-NBP1-85466-img0004.jpg)
![Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human lung shows high expression.](http://images.novusbio.com/images2/CD55-DAF-Antibody-Immunohistochemistry-Paraffin-NBP1-85466-img0005.jpg)
![Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining in human testis and skeletal muscle tissues using NBP1-88220 antibody. Corresponding CALB2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Calretinin-Antibody-Immunohistochemistry-Paraffin-NBP1-88220-img0024.jpg)
![Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human cerebellum, skeletal muscle, stomach and testis using Anti-CALB2 antibody NBP1-88220 (A) shows similar protein distribution across tissues to independent antibody NBP1-88221 (B).](http://images.novusbio.com/images2/Calretinin-Antibody-Immunohistochemistry-Paraffin-NBP1-88220-img0020.jpg)
![Western Blot: Calretinin Antibody [NBP1-88220] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/images2/Calretinin-Antibody-Western-Blot-NBP1-88220-img0018.jpg)
![Immunohistochemistry-Paraffin: CD21 Antibody (1F8) [NBP1-22527] - Human tonsil tissue section stained with CD21 antibody. IHC-P image submitted by a verified customer review.](http://images.novusbio.com/images2/CD21-Antibody-(1F8)-Immunohistochemistry-Paraffin-NBP1-22527-img0003.jpg)
![Immunohistochemistry-Paraffin: CD21 Antibody (1F8) [NBP1-22527] - Formalin fixed paraffin embedded human tonsil stained with CD21 antibody (NBP1-22527).](http://images.novusbio.com/images2/CD21-Antibody-(1F8)-Immunohistochemistry-Paraffin-NBP1-22527-img0002.jpg)
![Western Blot: DHRS4 Antibody [NBP2-98675] - Anti-DHRS4 rabbit polyclonal antibody at 1:500 dilution. Lane A: Hela Whole Cell Lysate Lane B: A549 Whole Cell Lysate Lane C: MCF7 Whole Cell Lysate Lane D: U-251 MG Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 30 kDa. Observed band size: 30 kDa](http://images.novusbio.com/images2/DHRS4-Antibody-Western-Blot-NBP2-98675-img0002.jpg)
![Immunohistochemistry-Paraffin: DHRS4 Antibody [NBP2-98675] - Immunochemical staining of human DHRS4 in human kidney with rabbit polyclonal antibody at 1:100 dilution, formalin-fixed paraffin embedded sections.](http://images.novusbio.com/images2/DHRS4-Antibody-Immunohistochemistry-Paraffin-NBP2-98675-img0003.jpg)
![Immunoprecipitation: DHRS4 Antibody [NBP2-98675] - DHRS4 was immunoprecipitated using: Lane A: 0.5 mg A549 Whole Cell Lysate 4 ul anti-DHRS4 rabbit polyclonal antibody and 60 ug of Immunomagnetic beads Protein A/G. Primary antibody: Anti-DHRS4 rabbit polyclonal antibody, at 1:100 dilution. Secondary antibody: Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 30 kDa. Observed band size: 30 kDa](http://images.novusbio.com/images2/DHRS4-Antibody-Immunoprecipitation-NBP2-98675-img0001.jpg)
![Western Blot: CRIPTO Antibody [NB100-1598] - Total protein from human HeLa, NTERA-2 and spleen and embryonic mouse V6.5 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-Cripto in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.](http://images.novusbio.com/images2/CRIPTO-Antibody-Western-Blot-NB100-1598-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: CRIPTO Antibody [NB100-1598] - CRIPTO antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).](http://images.novusbio.com/images2/CRIPTO-Antibody-Immunocytochemistry-Immunofluorescence-NB100-1598-img0010.jpg)
![Flow Cytometry: CRIPTO Antibody [NB100-1598] - An intracellular stain was performed on Jurkat with NB100-1598 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.](http://images.novusbio.com/images2/CRIPTO-Antibody-Flow-Cytometry-NB100-1598-img0012.jpg)
![Simple Western: Caspase-1 Antibody (14F468) [NB100-56565] - Simple Western lane view shows a specific band for Caspase 1 in 1.0 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/images2/Caspase-1-Antibody-(14F468)-Simple-Western-NB100-56565-img0013.jpg)
![Immunohistochemistry: Caspase-1 Antibody (14F468) [NB100-56565] - Activity of Casp1 in OHT-injured and normotensive control eyes. (A) Casp1 was detected by intraocular injection FLICA660-labeled substrate (green) in vivo 24 h after injury. Bright labeling (arrows) is evident in cells in the GCL and inner nuclear layer (INL) layers of the OHT-challenged retinas, a diffuse labeling of cell processes located in the IPL. Casp1 activity is diminished in Panx1-/- (Px1-/- OHT) retinas and WT retinas treated with probenecid (WT/Pbcd) at 12 h postinjury. Image collected and cropped by CiteAb from the following publication (https://www.frontiersin.org/article/10.3389/fnmol.2019.00036/full), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Caspase-1-Antibody-(14F468)-Immunohistochemistry-NB100-56565-img0019.jpg)
![Western Blot: Caspase-1 Antibody (14F468) [NB100-56565] - P. gingivalis and its OMVs differentially induce inflammasome signaling and pyroptosis in murine macrophages. BMM were infected as before (2 h at MOI of 25:1, see Materials and Methods) with viable P. gingivalis (Pg), heat-killed-Pg (HK-Pg), OMVs, or heat-inactivated-OMVs (HI-OMVs) and the activation of inflammasome components in the lysates [or supernatants (sup) where indicated] measured after 24 h by Western blot; beta-actin serves as a loading control throughout. Western blot data are representative of at least three independent experiments. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fcimb.2017.00351/full), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Caspase-1-Antibody-(14F468)-Western-Blot-NB100-56565-img0015.jpg)
![Western Blot: CES2 Antibody [NBP1-84556] - Analysis in human small intestine tissue.](http://images.novusbio.com/images2/CES2-Antibody-Western-Blot-NBP1-84556-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: CES2 Antibody [NBP1-84556] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.](http://images.novusbio.com/images2/CES2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84556-img0008.jpg)
![Immunohistochemistry-Paraffin: Carboxylesterase 2/CES2 Antibody [NBP1-84556] - CES2 Antibody [NBP1-84556] - Staining in human small intestine and pancreas tissues using anti-CES2 antibody. Corresponding CES2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/CES2-Antibody-Immunohistochemistry-Paraffin-NBP1-84556-img0011.jpg)
![Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of extracts of various cell lines, using Adenine Nucleotide Translocator 2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.](http://images.novusbio.com/images2/Adenine Nucleotide Translocator 2 Antibody-Western Blot-NBP2-92630-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of HeLa cells using Adenine Nucleotide Translocator 2. Blue: DAPI for nuclear staining.](http://images.novusbio.com/images2/Adenine-Nucleotide-Translocator-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92630-img0001.jpg)
![Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Paraffin-embedded rat heart using Adenine Nucleotide Translocator 2.](http://images.novusbio.com/images2/Adenine-Nucleotide-Translocator-2-Antibody-Immunohistochemistry-Paraffin-NBP2-92630-img0003.jpg)
![Western Blot: ACAT1 Antibody [NBP1-89284] - Analysis using Anti-ACAT1 antibody NBP1-89284 (A) shows similar pattern to independent antibody NBP1-89285 (B).](http://images.novusbio.com/images2/ACAT1-Antibody-Western-Blot-NBP1-89284-img0016.jpg)
![Immunocytochemistry/Immunofluorescence: ACAT1 Antibody [NBP1-89284] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/images2/ACAT1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89284-img0007.jpg)
![Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human cerebellum shows moderate positivity in mitochondria in Purkinje cells.](http://images.novusbio.com/images2/ACAT1-Antibody-Immunohistochemistry-Paraffin-NBP1-89284-img0014.jpg)
![Western Blot: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Analysis using Anti-SERPINA1 antibody NBP1-90309 (A) shows similar pattern to independent antibody NBP1-90308 (B).](http://images.novusbio.com/images2/Serpin-A1-alpha-1-Antitrypsin-Antibody-Western-Blot-NBP1-90309-img0023.jpg)
![Immunocytochemistry/Immunofluorescence: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/images2/Serpin-A1-alpha-1-Antitrypsin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90309-img0009.jpg)
![Immunohistochemistry: Serpin A1/alpha 1-Antitrypsin Antibody [NBP1-90309] - Assessment of CCL18 and A1AT (Serpin A1/alpha 1-Antitrypsin) in bladder tissue. Representative immunostaining of benign bladder for A1AT (top-left), low-grade non-muscle invasive BCa for A1AT (top-middle), and high-grade muscle invasive BCa for A1AT (top-right). A1AT staining was present in the cytoplasm and stroma. A1AT staining varied from weak and focal to strong and diffuse. Lower panel shows column bar graphs of A1AT immunohistochemical staining intensity of benign bladder vs. bladder cancer, low-grade vs. high-grade, NMIBC vs. MIBC. Image collected and cropped by CiteAb from the following publication (http://bmcurol.biomedcentral.com/articles/10.1186/1471-2490-13-42), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Serpin-A1-alpha-1-Antitrypsin-Antibody-Immunohistochemistry-NBP1-90309-img0030.jpg)
![Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - A. 30 ug A549 whole cell lysate/extract B. 30 ug HCT116 whole cell lysate/extract12 % SDS-PAGE GSTP1 antibody dilution: 1:5000](http://images.novusbio.com/images2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Western-Blot-NBP2-16756-img0015.jpg)
![Immunocytochemistry/Immunofluorescence: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GSTP1 protein stained by GSTP1 antibody diluted at 1:500. Red: alpha Tubulin, a cytoskeleton marker, stained by alpha Tubulin antibody diluted at 1:1000. Blue: Hoechst 33342 staining.](http://images.novusbio.com/images2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-16756-img0006.jpg)
![Immunohistochemistry-Paraffin: Glutathione S-Transferase pi 1/GSTP1 Antibody [NBP2-16756] - Analysis of paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/Glutathione-S-Transferase-pi-1-GSTP1-Antibody-Immunohistochemistry-Paraffin-NBP2-16756-img0014.jpg)
![Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Western-Blot-NBP2-34260-img0006.jpg)
![Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-NBP2-34260-img0005.jpg)
![Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)](http://images.novusbio.com/images2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-Paraffin-NBP2-34260-img0002.jpg)
![Immunohistochemistry: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - PAR1 is expressed by neural stem cells in the sub-ventricular zone (SVZ) of the adult mouse brain. Photomicrographs show immunofluorescence double-labeling for PAR1 with Sox2-positive multipotent neural stem cells (NSCs) within the lateral wall of the lateral ventricle (LV). RNAscope was used to identify cells expressing both PAR1 and Sox2. RNA in NSCs of the adult SVZ. Arrow indicates an example of a double-labeled cell in each case, with arrowhead indicating a singly labeled cell (Scale bar = 10 um). Boxed area in B is also shown at higher magnification to visualize double-labeled cells. Image collected and cropped by Cite Ab from the following publication (The Thrombin Receptor Restricts Subventricular Zone Neural Stem Cell Expansion and Differentiation. Sci Rep (2018) licensed under a CC-BY licence.](http://images.novusbio.com/images2/PAR1-Thrombin-Receptor-Antibody-(N2-11)-Immunohistochemistry-NBP1-71770-img0016.jpg)
![Western Blot: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of Thrombin Receptor expression in human testis using NBP1-71770.](http://images.novusbio.com/images2/PAR1-Thrombin-Receptor-Antibody-(N2-11)-Western-Blot-NBP1-71770-img0013.jpg)
![Immunohistochemistry: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - PAR1 is expressed by neural stem cells in the sub-ventricular zone (SVZ) of the adult mouse brain. Photomicrographs show immunofluorescence double-labeling for PAR1 with Nestin-positive multipotent neural stem cells (NSCs) within the lateral wall of the lateral ventricle (LV). RNAscope was used to identify cells expressing both PAR1 and Nestin. RNA in NSCs of the adult SVZ. Arrow indicates an example of a double-labeled cell in each case, with arrowhead indicating a singly labeled cell (Scale bar = 10 um). Boxed area in D is also shown at higher magnification to visualize double-labeled cells. Image collected and cropped by Cite Ab from the following publication (The Thrombin Receptor Restricts Subventricular Zone Neural Stem Cell Expansion and Differentiation. Sci Rep (2018) licensed under a CC-BY licence.](http://images.novusbio.com/images2/PAR1-Thrombin-Receptor-Antibody-(N2-11)-Immunohistochemistry-NBP1-71770-img0017.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")