Mer Recombinant Protein Antigen

Images

 
There are currently no images for Mer Recombinant Protein Antigen (NBP2-58025PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Mer Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Mer.

Source: E. coli

Amino Acid Sequence: PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MERTK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58025.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Mer Recombinant Protein Antigen

  • c-Eyk
  • c-mer proto-oncogene tyrosine kinase
  • C-mer
  • EC 2.7.10
  • EC 2.7.10.1
  • MER receptor tyrosine kinase
  • Mer
  • MerTK
  • MGC133349
  • Receptor tyrosine kinase MerTK
  • RP38Proto-oncogene c-Mer
  • STK kinase
  • tyrosine-protein kinase Mer

Background

MerTK (c-mer, Nyk, Eyk) is a tyrosine kinase that belongs to a family of transmembrane receptors (1). MerTk has been implicated in reversible cell growth arrest, survival, proliferation and cell adhesion. Growth arrest specific protein 6 (Gas6) is an activating ligand for MerTK (2-3). MerTK is required for clearance of apoptotic cells by mononuclear phagocytes in mice; with its absence resulting in progressive lupus like autoimmunity (4). Defects in MERTK are a cause of retinitis pigmentosa (RP) (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF854
Species: Mu
Applications: IHC, WB
885-GSB
Species: Hu
Applications: BA
AF759
Species: Mu
Applications: IHC, WB
NBP3-35469
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
H00023263-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
2805-MF
Species: Mu
Applications: Bind
AF5534
Species: Hu
Applications: Flow, IHC, WB
NBP1-90096
Species: Hu
Applications: IHC, IHC-P
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
MAB4467
Species: Hu
Applications: IHC, KO, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB

Publications for Mer Recombinant Protein Antigen (NBP2-58025PEP) (0)

There are no publications for Mer Recombinant Protein Antigen (NBP2-58025PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mer Recombinant Protein Antigen (NBP2-58025PEP) (0)

There are no reviews for Mer Recombinant Protein Antigen (NBP2-58025PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Mer Recombinant Protein Antigen (NBP2-58025PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mer Products

Research Areas for Mer Recombinant Protein Antigen (NBP2-58025PEP)

Find related products by research area.

Blogs on Mer

There are no specific blogs for Mer, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Mer Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MERTK