Mer Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Mer Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Mer.

  Source: E. coli

  Amino Acid Sequence: PDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MERTK
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58025.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Mer Recombinant Protein Antigen

• c-Eyk
• c-mer proto-oncogene tyrosine kinase
• C-mer
• EC 2.7.10
• EC 2.7.10.1
• MER receptor tyrosine kinase
• Mer
• MerTK
• MGC133349
• Receptor tyrosine kinase MerTK
• RP38Proto-oncogene c-Mer
• STK kinase
• tyrosine-protein kinase Mer

Background

MerTK (c-mer, Nyk, Eyk) is a tyrosine kinase that belongs to a family of transmembrane receptors (1). MerTk has been implicated in reversible cell growth arrest, survival, proliferation and cell adhesion. Growth arrest specific protein 6 (Gas6) is an activating ligand for MerTK (2-3). MerTK is required for clearance of apoptotic cells by mononuclear phagocytes in mice; with its absence resulting in progressive lupus like autoimmunity (4). Defects in MERTK are a cause of retinitis pigmentosa (RP) (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MERTK