We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Meprin alpha Subunit/MEP1A Recombinant Protein Antigen

Images

 
There are currently no images for Meprin alpha Subunit/MEP1A Protein (NBP1-87238PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Meprin alpha Subunit/MEP1A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MEP1A.

Source: E. coli

Amino Acid Sequence: MSSSMVFTTSKSHTSPAINDTVIWDRPSRVGTYHTDCNCFRSIDLGWSGFISHQMLKRRSFLKNDDLIIFVDFEDITHLSQTEVPTKGKRLSPQGLILQGQEQQVSEEGSGKAMLEEALPVSLSQGQPSRQKRSVE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MEP1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87238.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Meprin alpha Subunit/MEP1A Recombinant Protein Antigen

  • bA268F1.1 (meprin A alpha (PABA peptide hydrolase))
  • EC 3.4.24
  • EC 3.4.24.18
  • endopeptidase-2
  • MEP1A
  • meprin A subunit alpha
  • meprin A, alpha (PABA peptide hydrolase)
  • Meprin alpha Subunit
  • N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase subunit alpha
  • PABA peptide hydrolase
  • PPH alpha
  • PPHA

Background

Meprins are multidomain zinc metalloproteases that are highly expressed in mammalian kidney and intestinal brush border membranes and in leukocytes and certain cancer cells. Mature meprins are oligomers of evolutionarily related, separately encoded alpha and/or beta subunits. Homooligomers of meprin-alpha are secreted; oligomers containing meprin-beta are associated with the plasma membrane. Substrates include bioactive peptides and extracellular matrix proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3300
Species: Mu
Applications: IHC, IP, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-92546
Species: Hu, Mu, Rt
Applications: ELISA, WB
H00003930-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-33903
Species: Hu
Applications: IHC,  IHC-P
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP2-47559
Species: Hu
Applications: IHC,  IHC-P, WB
AF1396
Species: Hu
Applications: WB
NBP1-62583
Species: Hu
Applications: WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-87238PEP
Species: Hu
Applications: AC

Publications for Meprin alpha Subunit/MEP1A Protein (NBP1-87238PEP) (0)

There are no publications for Meprin alpha Subunit/MEP1A Protein (NBP1-87238PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Meprin alpha Subunit/MEP1A Protein (NBP1-87238PEP) (0)

There are no reviews for Meprin alpha Subunit/MEP1A Protein (NBP1-87238PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Meprin alpha Subunit/MEP1A Protein (NBP1-87238PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Meprin alpha Subunit/MEP1A Products

Blogs on Meprin alpha Subunit/MEP1A

There are no specific blogs for Meprin alpha Subunit/MEP1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Meprin alpha Subunit/MEP1A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MEP1A