We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Mena Recombinant Protein Antigen

Images

 
There are currently no images for Mena Protein (NBP1-87915PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Mena Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ENAH.

Source: E. coli

Amino Acid Sequence: STSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ENAH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87915.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Mena Recombinant Protein Antigen

  • ENA
  • enabled homolog (Drosophila)
  • ENAH
  • FLJ10773
  • Mena
  • MENANDPP1
  • NDPP1
  • protein enabled homolog

Background

ENAH/MENA belongs to the Ena/vasodilator-stimulated phosphoprotein (VASP) family of proteins which play a role in regulating the actin cytoskeleton for the control of cell shape and movement. The Ena/VASP family of actin binding proteins includes ENAH/MENA which is the human homolog of drosophila Ena (enabled), VASP, and EVL (Ena/vasodilator-stimulated phosphoprotein-like protein). Ena/VASP proteins contain an EVH1 domain, a central proline-rich domain, and a terminal EVH2 domain. ENAH/MENA is not expressed in normal breast but has been detected and associated with breast lesions with a high risk of transformation and primary and metastatic breast cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00555
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-80831
Species: Hu
Applications: IHC,  IHC-P, WB
H00007791-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, KD, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PA, Simple Western, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF5414
Species: Hu
Applications: Simple Western, WB
AF1444
Species: Mu
Applications: IHC, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
DY443
Species: Mu
Applications: ELISA
MAB6896
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-82512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NB110-58360
Species: Hu, Mu, Rt
Applications: IP, WB
NBP1-88711
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-87122
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02577
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB

Publications for Mena Protein (NBP1-87915PEP) (0)

There are no publications for Mena Protein (NBP1-87915PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mena Protein (NBP1-87915PEP) (0)

There are no reviews for Mena Protein (NBP1-87915PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Mena Protein (NBP1-87915PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mena Products

Research Areas for Mena Protein (NBP1-87915PEP)

Find related products by research area.

Blogs on Mena.

Chemotherapy-induced metastasis: An unexpected foe?
By Yoskaly Lazo-Fernandez, PhD IntroductionEvidence has accumulated recently indicating that common cancer therapies might stimulate metastasis in a significant number of cancer patients1. In fact, neoadjuvant che...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Mena Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ENAH