Recombinant Human Mena Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Mena Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 291-390 of Human ENAH partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLT

Protein/Peptide Type
Partial Recombinant Protein
Gene
ENAH

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Mena Protein

  • ENA
  • enabled homolog (Drosophila)
  • ENAH
  • FLJ10773
  • Mena
  • MENANDPP1
  • NDPP1
  • protein enabled homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38132
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5414
Species: Hu
Applications: WB, Simple Western
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NB110-58360
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-00810
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19344
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-49154
Species: Hu
Applications: IHC
H00055740-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Mena Partial Recombinant Protein (H00055740-Q01) (0)

There are no publications for Mena Partial Recombinant Protein (H00055740-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mena Partial Recombinant Protein (H00055740-Q01) (0)

There are no reviews for Mena Partial Recombinant Protein (H00055740-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mena Partial Recombinant Protein (H00055740-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mena Products

Bioinformatics Tool for Mena Partial Recombinant Protein (H00055740-Q01)

Discover related pathways, diseases and genes to Mena Partial Recombinant Protein (H00055740-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mena Partial Recombinant Protein (H00055740-Q01)

Discover more about diseases related to Mena Partial Recombinant Protein (H00055740-Q01).
 

Pathways for Mena Partial Recombinant Protein (H00055740-Q01)

View related products by pathway.

PTMs for Mena Partial Recombinant Protein (H00055740-Q01)

Learn more about PTMs related to Mena Partial Recombinant Protein (H00055740-Q01).
 

Research Areas for Mena Partial Recombinant Protein (H00055740-Q01)

Find related products by research area.

Blogs on Mena

There are no specific blogs for Mena, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Mena Antibody
NBP1-87914

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Mena Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ENAH
Entrez