MEFV Antibody (2C1)

Images

 
Immunocytochemistry/ Immunofluorescence: MEFV Antibody (2C1) [H00004210-M02] - Analysis of monoclonal antibody to MEFV on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: MEFV Antibody (2C1) [H00004210-M02] - Detection limit for recombinant GST tagged MEFV is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MEFV Antibody (2C1) Summary

Immunogen
MEFV (NP_000234, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTYYGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSL
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MEFV
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MEFV Antibody (2C1)

  • FMF
  • FMFmarenostrin
  • Marenostrin
  • Mediterranean fever
  • MEFpyrin
  • MGC126560
  • MGC126586
  • TRIM20

Background

This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity. Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-55967
Species: Hu
Applications: ICC/IF
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00004210-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for MEFV Antibody (H00004210-M02) (0)

There are no publications for MEFV Antibody (H00004210-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEFV Antibody (H00004210-M02) (0)

There are no reviews for MEFV Antibody (H00004210-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MEFV Antibody (H00004210-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEFV Products

Bioinformatics Tool for MEFV Antibody (H00004210-M02)

Discover related pathways, diseases and genes to MEFV Antibody (H00004210-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEFV Antibody (H00004210-M02)

Discover more about diseases related to MEFV Antibody (H00004210-M02).
 

Pathways for MEFV Antibody (H00004210-M02)

View related products by pathway.

PTMs for MEFV Antibody (H00004210-M02)

Learn more about PTMs related to MEFV Antibody (H00004210-M02).

Blogs on MEFV

There are no specific blogs for MEFV, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEFV Antibody (2C1) and receive a gift card or discount.

Bioinformatics

Gene Symbol MEFV
Uniprot