MEF2B Antibody (4B5)

Images

 
Western Blot: MEF2B Antibody (4B5) [H00004207-M24] - Analysis of MEF2B expression in human stomach.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
4B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MEF2B Antibody (4B5) Summary

Immunogen
MEF2B (NP_005910.1, 165 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP
Specificity
MEF2B (4B5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MEF2BNB-MEF2B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against tissue lysate and recombinant protein for WB. It has been used for ELISA.
Publications
Read Publication using H00004207-M24.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MEF2B Antibody (4B5)

  • LOC729991-MEF2B readthrough transcript
  • MEF2B
  • myocyte enhancer factor 2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004205-M15
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-17260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-85788
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-31546
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-91745
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-71927
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF2848
Species: Hu, Mu
Applications: ICC, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
236-EG
Species: Hu
Applications: BA
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DPG00
Species: Hu
Applications: ELISA
NBP1-52030
Species: Hu
Applications: PEP-ELISA, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-26626
Species: Hu
Applications: IHC, IHC-P, IP, WB

Publications for MEF2B Antibody (H00004207-M24)(1)

Reviews for MEF2B Antibody (H00004207-M24) (0)

There are no reviews for MEF2B Antibody (H00004207-M24). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEF2B Antibody (H00004207-M24) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MEF2B Products

Bioinformatics Tool for MEF2B Antibody (H00004207-M24)

Discover related pathways, diseases and genes to MEF2B Antibody (H00004207-M24). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MEF2B

There are no specific blogs for MEF2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEF2B Antibody (4B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol MEF2BNB-MEF2B
Entrez
OMIM
Uniprot