MEF2B Antibody (4B5)

Western Blot: MEF2B Antibody (4B5) [H00004207-M24] - Analysis of MEF2B expression in human stomach.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 4B5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

MEF2B Antibody (4B5) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MEF2B (NP_005910.1, 165 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP
• Specificity: MEF2B (4B5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MEF2BNB-MEF2B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against tissue lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MEF2B Antibody (4B5)

• LOC729991-MEF2B readthrough transcript
• MEF2B
• myocyte enhancer factor 2B

Background

The MEF2B gene represents numerous read-through transcripts that span geneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be non-coding. Some transcripts are predicted to b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MEF2B Antibody (H00004207-M24)(1)

Publication using H00004207-M24

• El Jamal SM, Grada Z, El Dinali MH et al. MEF2B is a member of the BCL6 gene transcriptional complex and induces its expression in diffuse large B-cell lymphoma of the germinal center B-cell-like type. Lab Invest. 2018-11-16 [PMID: 30446717]

Bioinformatics

• Gene Symbol: MEF2BNB-MEF2B
• Entrez:
  • 4207(Human)
• OMIM:
  • 600661(Human)
• Uniprot:
  • NP_005910(Human)