MED8 Antibody (1E5) - Azide and BSA Free

Western Blot: MED8 Antibody (1E5) [H00112950-M08] - Detection against Immunogen (32.23 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1E5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MED8 Antibody (1E5) - Azide and BSA Free Summary

• Immunogen: MED8 (NP_443109, 1 a.a. ~ 59 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCS
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MED8
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MED8 Antibody (1E5) - Azide and BSA Free

• ARC32subunit 8 homolog
• mediator complex subunit 8mediator of RNA polymerase II transcription, subunit 8 homolog (S. cerevisiae)

Background

This gene encodes a protein that is one of more than 20 subunits of the mediator complex, first identified in S. cerevisiae, that is required for activation of transcription. The product of this gene also interacts with elongins B and C, and CUL2 and RBX1, to reconstitute a ubiquitin ligase. Two alternative transcripts encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MED8
• Uniprot:
  • NP_443109(Human)