MED6 Antibody

Images

 
Western Blot: MED6 Antibody [NBP2-55253] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: MED6 Antibody [NBP2-55253] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQDKVRPKAKRKEEPSSI
Specificity
Specificity of human MED6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MED6 Antibody

  • Activator-recruited cofactor 33 kDa component
  • ARC33
  • mediator complex subunit 6hMed6
  • mediator of RNA polymerase II transcription subunit 6
  • mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae)
  • mediator of RNA polymerase II transcription, subunit 6 homolog
  • NY-REN-28
  • Renal carcinoma antigen NY-REN-28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2574
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IHC-Fr (-)
NBP1-87006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56318
Species: Hu
Applications: ICC/IF
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBL1-11392
Species: Hu
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP2-30407
Species: Hu
Applications: WB, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-61060
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP1-89014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009440-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
H00009443-M01
Species: Hu
Applications: WB, ELISA
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NB600-507
Species: Hu, Mu, Rt, Rb
Applications: WB, PEP-ELISA
NBP1-85104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, ChIP, CHIP-SEQ, KD
NBP2-55253
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for MED6 Antibody (NBP2-55253) (0)

There are no publications for MED6 Antibody (NBP2-55253).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED6 Antibody (NBP2-55253) (0)

There are no reviews for MED6 Antibody (NBP2-55253). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MED6 Antibody (NBP2-55253) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MED6 Products

Bioinformatics Tool for MED6 Antibody (NBP2-55253)

Discover related pathways, diseases and genes to MED6 Antibody (NBP2-55253). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED6 Antibody (NBP2-55253)

Discover more about diseases related to MED6 Antibody (NBP2-55253).
 

Pathways for MED6 Antibody (NBP2-55253)

View related products by pathway.

PTMs for MED6 Antibody (NBP2-55253)

Learn more about PTMs related to MED6 Antibody (NBP2-55253).

Blogs on MED6

There are no specific blogs for MED6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED6