MED31 Antibody - BSA Free

Western Blot: MED31 Antibody [NBP2-87794] - Host: Rabbit. Target Name: Med31. Sample Type: Rat Testis lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MED31 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat MED31. Peptide sequence: YEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNTTAG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MED31
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MED31 Antibody - BSA Free

• CGI-125
• FLJ27436
• FLJ36714
• hSOH1
• mediator complex subunit 313110004H13Rik
• Mediator complex subunit SOH1
• mediator of RNA polymerase II transcription subunit 31
• mediator of RNA polymerase II transcription, subunit 31 homolog (S. cerevisiae)
• mediator of RNA polymerase II transcription, subunit 31 homolog
• SOH1

Background

MED31 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymera

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MED31