MED18 Antibody


Immunocytochemistry/ Immunofluorescence: MED18 Antibody [NBP1-83673] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli.
Immunohistochemistry-Paraffin: MED18 Antibody [NBP1-83673] - Staining of human gall bladder shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

MED18 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:RARRSMDRAGAPWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVAKGH
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
MED18 Protein (NBP1-83673PEP)

Alternate Names for MED18 Antibody

  • FLJ20045
  • mediator complex subunit 18mediator of RNA polymerase II transcription subunit 18
  • mediator of RNA polymerase II transcription, subunit 18 homolog (S. cerevisiae)
  • p28bmediator of RNA polymerase II transcription, subunit 18 homolog
  • TRAP/mediator complex subunit p28b


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for MED18 Antibody (NBP1-83673) (0)

There are no publications for MED18 Antibody (NBP1-83673).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED18 Antibody (NBP1-83673) (0)

There are no reviews for MED18 Antibody (NBP1-83673). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MED18 Antibody (NBP1-83673) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MED18 Antibody Products

Related Products by Gene

Bioinformatics Tool for MED18 Antibody (NBP1-83673)

Discover related pathways, diseases and genes to MED18 Antibody (NBP1-83673). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED18 Antibody (NBP1-83673)

Discover more about diseases related to MED18 Antibody (NBP1-83673).

Pathways for MED18 Antibody (NBP1-83673)

View related products by pathway.

PTMs for MED18 Antibody (NBP1-83673)

Learn more about PTMs related to MED18 Antibody (NBP1-83673).

Blogs on MED18

There are no specific blogs for MED18, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our MED18 Antibody and receive a gift card or discount.


Gene Symbol MED18

Customers Who Bought This Also Bought