MED18 Antibody


Immunocytochemistry/ Immunofluorescence: MED18 Antibody [NBP1-83673] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MED18 Antibody [NBP1-83673] - Staining of human colon shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

MED18 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RARRSMDRAGAPWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVAKGH
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED18 Protein (NBP1-83673PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MED18 Antibody

  • FLJ20045
  • mediator complex subunit 18mediator of RNA polymerase II transcription subunit 18
  • mediator of RNA polymerase II transcription, subunit 18 homolog (S. cerevisiae)
  • p28bmediator of RNA polymerase II transcription, subunit 18 homolog
  • TRAP/mediator complex subunit p28b


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IP, KO
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB
Species: Hu, Rt, Po, Pm, Bv, Gt, Pm, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for MED18 Antibody (NBP1-83673) (0)

There are no publications for MED18 Antibody (NBP1-83673).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED18 Antibody (NBP1-83673) (0)

There are no reviews for MED18 Antibody (NBP1-83673). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MED18 Antibody (NBP1-83673) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MED18 Products

Bioinformatics Tool for MED18 Antibody (NBP1-83673)

Discover related pathways, diseases and genes to MED18 Antibody (NBP1-83673). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED18 Antibody (NBP1-83673)

Discover more about diseases related to MED18 Antibody (NBP1-83673).

Pathways for MED18 Antibody (NBP1-83673)

View related products by pathway.

PTMs for MED18 Antibody (NBP1-83673)

Learn more about PTMs related to MED18 Antibody (NBP1-83673).

Blogs on MED18

There are no specific blogs for MED18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MED18 Antibody and receive a gift card or discount.


Gene Symbol MED18