MED18 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MED18 Antibody [NBP1-83673] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli.
Immunohistochemistry-Paraffin: MED18 Antibody [NBP1-83673] - Immunohistochemical staining of human gall bladder shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MouseSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

MED18 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RARRSMDRAGAPWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVAKGH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
MED18 Protein (NBP1-83673PEP)

Alternate Names for MED18 Antibody

  • FLJ20045
  • mediator complex subunit 18mediator of RNA polymerase II transcription subunit 18
  • mediator of RNA polymerase II transcription, subunit 18 homolog (S. cerevisiae)
  • p28bmediator of RNA polymerase II transcription, subunit 18 homolog
  • TRAP/mediator complex subunit p28b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89015
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010001-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP2-12933
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-45780
Species: Hu
Applications: WB, IHC
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-85104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009440-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5510
Species: Hu
Applications: WB
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87094
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-83673
Species: Hu, Mouse
Applications: ICC/IF, IHC, IHC-P

Publications for MED18 Antibody (NBP1-83673) (0)

There are no publications for MED18 Antibody (NBP1-83673).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED18 Antibody (NBP1-83673) (0)

There are no reviews for MED18 Antibody (NBP1-83673). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MED18 Antibody (NBP1-83673) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED18 Antibody Products

Related Products by Gene

Bioinformatics Tool for MED18 Antibody (NBP1-83673)

Discover related pathways, diseases and genes to MED18 Antibody (NBP1-83673). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED18 Antibody (NBP1-83673)

Discover more about diseases related to MED18 Antibody (NBP1-83673).
 

Pathways for MED18 Antibody (NBP1-83673)

View related products by pathway.

PTMs for MED18 Antibody (NBP1-83673)

Learn more about PTMs related to MED18 Antibody (NBP1-83673).

Blogs on MED18

There are no specific blogs for MED18, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol MED18

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-83673 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought