MED18 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MED18 Antibody [NBP1-83673] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MED18 Antibody [NBP1-83673] - Staining of human gall bladder shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED18 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RARRSMDRAGAPWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVAKGH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
MED18 Protein (NBP1-83673PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED18 Antibody

  • FLJ20045
  • mediator complex subunit 18mediator of RNA polymerase II transcription subunit 18
  • mediator of RNA polymerase II transcription, subunit 18 homolog (S. cerevisiae)
  • p28bmediator of RNA polymerase II transcription, subunit 18 homolog
  • TRAP/mediator complex subunit p28b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89015
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38118
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-89018
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-85104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009440-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5510
Species: Hu
Applications: WB
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87094
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1705
Species: Mu
Applications: WB, IHC

Publications for MED18 Antibody (NBP1-83673) (0)

There are no publications for MED18 Antibody (NBP1-83673).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED18 Antibody (NBP1-83673) (0)

There are no reviews for MED18 Antibody (NBP1-83673). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MED18 Antibody (NBP1-83673) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED18 Antibody Products

Related Products by Gene

Bioinformatics Tool for MED18 Antibody (NBP1-83673)

Discover related pathways, diseases and genes to MED18 Antibody (NBP1-83673). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED18 Antibody (NBP1-83673)

Discover more about diseases related to MED18 Antibody (NBP1-83673).
 

Pathways for MED18 Antibody (NBP1-83673)

View related products by pathway.

PTMs for MED18 Antibody (NBP1-83673)

Learn more about PTMs related to MED18 Antibody (NBP1-83673).

Blogs on MED18

There are no specific blogs for MED18, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED18

Customers Who Bought This Also Bought