MED14 Antibody

Images

 
Western Blot: MED14 Antibody [NBP2-83187] - WB Suggested Anti-MED14 Antibody Titration: 0.2-1 ug/ml. Positive Control: A549 cell lysateMED14 is strongly supported by BioGPS gene expression data to be expressed in Human ...read more
Chromatin Immunoprecipitation: MED14 Antibody [NBP2-83187] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED14 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MED14. Peptide sequence: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MED14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED14 Antibody

  • Activator-recruited cofactor 150 kDa component
  • ARC150
  • Cofactor required for Sp1 transcriptional activation subunit 2
  • cofactor required for Sp1 transcriptional activation, subunit 2 (150kD)
  • CRSP150
  • CRSP2cofactor required for Sp1 transcriptional activation, subunit 2, 150kDa
  • CSRP
  • CXorf4MGC104513
  • EXLM1CRSP complex subunit 2
  • human homolog of yeast RGR1
  • mediator complex subunit 14DRIP150
  • mediator of RNA polymerase II transcription subunit 14
  • RGR1RGR1 homolog
  • Thyroid hormone receptor-associated protein complex 170 kDa component
  • thyroid hormone receptor-associated protein complex component TRAP170
  • Transcriptional coactivator CRSP150
  • transcriptional co-activator CRSP150
  • Trap170
  • TRAP170hRGR1
  • vitamin D receptor-interacting protein complex component DRIP150
  • Vitamin D3 receptor-interacting protein complex 150 kDa component

Background

The activation of gene transcription is a multi-step process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multi-subunit complexes e.g. thyroid hormone receptor (TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5520
Species: Hu, Mu
Applications: WB
NB100-74599
Species: Hu, Mu
Applications: IP, WB
NBP1-91189
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, WB (-)
NBP3-13814
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
H00009440-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-84377
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010001-D01P
Species: Hu, Mu
Applications: WB
NBP2-44479
Species: Hu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
NB200-337
Species: Hu, Mu
Applications: ChIP, IP, WB (-)
H00009443-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NB600-507
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, PEP-ELISA, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
NBP3-13045
Species: Hu
Applications: ICC/IF, WB
NBP3-13787
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA, WB

Publications for MED14 Antibody (NBP2-83187) (0)

There are no publications for MED14 Antibody (NBP2-83187).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED14 Antibody (NBP2-83187) (0)

There are no reviews for MED14 Antibody (NBP2-83187). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Webinar
ChIP Video Protocol

FAQs for MED14 Antibody (NBP2-83187) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED14 Products

Array NBP2-83187

Bioinformatics Tool for MED14 Antibody (NBP2-83187)

Discover related pathways, diseases and genes to MED14 Antibody (NBP2-83187). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED14 Antibody (NBP2-83187)

Discover more about diseases related to MED14 Antibody (NBP2-83187).
 

Pathways for MED14 Antibody (NBP2-83187)

View related products by pathway.

PTMs for MED14 Antibody (NBP2-83187)

Learn more about PTMs related to MED14 Antibody (NBP2-83187).
 

Research Areas for MED14 Antibody (NBP2-83187)

Find related products by research area.

Blogs on MED14

There are no specific blogs for MED14, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED14