MED14 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MED14. Peptide sequence: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MED14 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Chromatin Immunoprecipitation (ChIP)
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for MED14 Antibody - BSA Free
Background
The activation of gene transcription is a multi-step process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multi-subunit complexes e.g. thyroid hormone receptor (TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, WB (-)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IP, WB (-)
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, PEP-ELISA, WB
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA, WB
Publications for MED14 Antibody (NBP2-83187) (0)
There are no publications for MED14 Antibody (NBP2-83187).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MED14 Antibody (NBP2-83187) (0)
There are no reviews for MED14 Antibody (NBP2-83187).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MED14 Antibody (NBP2-83187) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MED14 Products
Research Areas for MED14 Antibody (NBP2-83187)
Find related products by research area.
|
Blogs on MED14