MCPH1 Antibody (5C9) Summary
Immunogen |
MCPH1 (NP_078872, 399 a.a. ~ 487 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ATSSCVTSAPEEALRCCRQAGKEDACPEGNGFSYTIEDPALPKGHDDDLTPLEGSLEEMKEAVGLKSTQNKGTTSKISNSSEGEAQSEH |
Specificity |
MCPH1 - microcephaly, primary autosomal recessive 1 |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
MCPH1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MCPH1 Antibody (5C9)
Background
MCPH-1 was identified in a screen for negative regulators of hTERT (human telomerase) expression. It has been implicated in chromosome condensation and DNA damage induced cellular responses. It may play a role in neurogenesis and regulation of the size of the cerebral cortex. Defects in MCPH1 are the cause of primary microcephaly 1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: WB, ELISA
Publications for MCPH1 Antibody (H00079648-M07) (0)
There are no publications for MCPH1 Antibody (H00079648-M07).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MCPH1 Antibody (H00079648-M07) (0)
There are no reviews for MCPH1 Antibody (H00079648-M07).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MCPH1 Antibody (H00079648-M07) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MCPH1 Products
Bioinformatics Tool for MCPH1 Antibody (H00079648-M07)
Discover related pathways, diseases and genes to MCPH1 Antibody (H00079648-M07). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for MCPH1 Antibody (H00079648-M07)
Discover more about diseases related to MCPH1 Antibody (H00079648-M07).
| | Pathways for MCPH1 Antibody (H00079648-M07)
View related products by pathway.
|
PTMs for MCPH1 Antibody (H00079648-M07)
Learn more about PTMs related to MCPH1 Antibody (H00079648-M07).
| | Research Areas for MCPH1 Antibody (H00079648-M07)
Find related products by research area.
|
Blogs on MCPH1