MCM9 Antibody - BSA Free

Western Blot: MCM9 Antibody [NBP1-58128] - Antibody Titration: 1 ug/ml Human liver.

Western Blot: MCM9 Antibody [NBP1-58128] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MCM9 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MCM9(minichromosome maintenance complex component 9) The peptide sequence was selected from the N terminal of human MCM9. Peptide sequence NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MCM9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MCM9 Antibody - BSA Free

• C6orf61
• chromosome 6 open reading frame 61
• dJ329L24.1
• dJ329L24.3
• DNA replication licensing factor MCM9
• FLJ13942
• FLJ20170
• FLJ56845
• hMCM9
• MCMDC1
• MGC35304
• minichromosome maintenance complex component 9
• Mini-chromosome maintenance deficient 9
• minichromosome maintenance deficient domain containing 1
• Mini-chromosome maintenance deficient domain-containing protein 1

Background

MCM9 is a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.This gene encodes a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MCM9
• Entrez:
  • 254394(Human)
• Uniprot:
  • B3KV41(Human)