MCM5 Antibody (4P1Q5)

Western Blot: MCM5 Antibody (4P1Q5) [NBP3-16529] - Western blot analysis of extracts of various cell lines, using MCM5 Rabbit mAb (NBP3-16529) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Immunohistochemistry-Paraffin: MCM5 Antibody (4P1Q5) [NBP3-16529] - Immunohistochemistry of paraffin-embedded human colon using MCM5 Rabbit mAb (NBP3-16529) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: MCM5 Antibody (4P1Q5) [NBP3-16529] - Immunohistochemistry of paraffin-embedded rat testis using MCM5 Rabbit mAb (NBP3-16529) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunoprecipitation: MCM5 Antibody (4P1Q5) [NBP3-16529] - Immunoprecipitation analysis of 300ug extracts of MCF7 cells using 3ug MCM5 antibody (NBP3-16529). Western blot was performed from the immunoprecipitate using MCM5 antibody (NBP3-16529) at a dilition of 1:1000.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC, IP
• Clone: 4P1Q5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

MCM5 Antibody (4P1Q5) Summary

• Description: Novus Biologicals Rabbit MCM5 Antibody (4P1Q5) (NBP3-16529) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 635-734 of human MCM5 (P33992). ADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGEIQHRMQRKVLYRLK
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MCM5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 82 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MCM5 Antibody (4P1Q5)

• CDC46 homolog
• CDC46DNA replication licensing factor MCM5
• EC 3.6.4.12
• MCM5 minichromosome maintenance deficient 5, cell division cycle 46 (S.cerevisiae)
• MCM5 minichromosome maintenance deficient 5, cell division cycle 46
• MGC5315
• minichromosome maintenance complex component 5
• minichromosome maintenance deficient (S. cerevisiae) 5 (cell division cycle 46)
• minichromosome maintenance deficient 5 (cell division cycle 46)
• P1-CDC46

Background

MCM5 (Mini Chromosome Maintenance protein-5) is involved in the control of DNA replication. MCM proteins have DNA dependent ATPase motifs in their central domain which is conserved from yeast to mammals. MCM proteins form a complex which exhibits ATPase and helicase activities. In G0 phase levels of MCM 2 and 5 are lower than that of MCM7 and 3 but increase as the cell enters G1/S phase of the cell cycle. It has been reported that immunocytochemical assessment of Mcm5 expression may be of value in improving the accuracy of cervical smear testing for the detection of malignancy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MCM5