MCM4 Antibody (1A6)

Images

 
There are currently no images for MCM4 Antibody (H00004173-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MCM4 Antibody (1A6) Summary

Immunogen
MCM4 (AAH31061, 267 a.a. ~ 366 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQT
Specificity
MCM4 - MCM4 minichromosome maintenance deficient 4 (S. cerevisiae) (1A6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MCM4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MCM4 Antibody (1A6)

  • CDC21 homolog
  • CDC21
  • CDC54
  • DNA replication licensing factor MCM4
  • EC 3.6.4.12
  • hCdc21
  • homolog of S. pombe cell devision cycle 21
  • MCM4 minichromosome maintenance deficient 4 (S. cerevisiae)
  • MCM4 minichromosome maintenance deficient 4
  • MGC33310
  • minichromosome maintenance complex component 4
  • minichromosome maintenance deficient 4
  • P1-Cdc21

Background

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004176-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-288
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-79778
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-82642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-75569
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15837
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67897
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-32708
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2567
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-22128
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-01184
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-34390
Species: Hu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010926-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
H00004173-M01
Species: Hu
Applications: ELISA

Publications for MCM4 Antibody (H00004173-M01) (0)

There are no publications for MCM4 Antibody (H00004173-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCM4 Antibody (H00004173-M01) (0)

There are no reviews for MCM4 Antibody (H00004173-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MCM4 Antibody (H00004173-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCM4 Products

Bioinformatics Tool for MCM4 Antibody (H00004173-M01)

Discover related pathways, diseases and genes to MCM4 Antibody (H00004173-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM4 Antibody (H00004173-M01)

Discover more about diseases related to MCM4 Antibody (H00004173-M01).
 

Pathways for MCM4 Antibody (H00004173-M01)

View related products by pathway.

PTMs for MCM4 Antibody (H00004173-M01)

Learn more about PTMs related to MCM4 Antibody (H00004173-M01).
 

Research Areas for MCM4 Antibody (H00004173-M01)

Find related products by research area.

Blogs on MCM4.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCM4 Antibody (1A6) and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM4
Entrez
Uniprot