MCCC1 Antibody - BSA Free

Staining of human cell line SiHa shows localization to mitochondria.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MCCC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MCCC1 Antibody - BSA Free (NBP3-24973) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein MCCC1 using the following amino acid sequence: LLLSRKAAAKESLCQAALGLILKEKAMTDTFTLQAHDQFSPFSSSSGRRLNISYTRNMTLKDGKNNVAIAVTYNHDGSYSMQIEDKTF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MCCC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MCCC1 Antibody - BSA Free

• 3-methylcrotonyl-CoA carboxylase 1
• DKFZp686B20267
• EC 6.4.1
• EC 6.4.1.4
• MCCAFLJ25545
• MCC-B
• methylcrotonoyl-CoA carboxylase 1 (alpha)
• methylcrotonoyl-Coenzyme A carboxylase 1 (alpha)
• mitochondrial

Background

MCCC1, also known as Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial, is a 725 amino acid protein that is 80 kDa, located in mitochondrion matrix, functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Studies on this protein have shown a relationship with the following diseases and disorders: 3 methylcrotonyl-coa carboxylase 1 deficiency, pseudomyxoma peritonei, mucinous cystadenocarcinoma, cystadenocarcinoma, 3-methylcrotonyl-coa carboxylase deficiency, carnitine deficiency, neisseria meningitides, Parkinson's disease, hypotonia, pneumonia, and tuberculosis. This protein has also been shown to have interactions with PPP2R2B, YWHAB, ACADM, AUH and ECHS1 in valine, leucine and isoleucine degradation, metabolic pathways, metabolism of amino acids and derivatives, and branched-chain amino acid catabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MCCC1