MCC2 Antibody

Images

 
Immunohistochemistry: MCC2 Antibody [NBP2-30804] - Staining of human small intestine shows distinct positivity in erythrocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCC2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TLQHTLSSLEAAAAAWRHQPPSHSGPMEFEGTSEGGAGSLGKQEGAGSCQREAARLAERNAWLRLALSSREDELVRTQASLEAIRAEKETLQKEVQELQDSLLRLEPCPHLSHNQAGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USHBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MCC2 Protein (NBP2-30804PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCC2 Antibody

  • AIE-75 Binding Protein Protein
  • AIE-75-Binding Protein
  • AIEBP
  • MCC-2
  • Mutated In Colon Cancer Protein 2
  • USH1C-Binding Protein 1
  • USHBP1
  • Usher Syndrome 1C Binding Protein 1
  • Usher Syndrome Type-1C Protein-Binding Protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89189
Species: Hu
Applications: IHC, IHC-P
NBP1-85885
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
126-FL/CF
Species: Hu
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
796-IC
Species: Mu
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP2-31752
Species: Hu
Applications: IHC, IHC-P
H00023049-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for MCC2 Antibody (NBP2-30804) (0)

There are no publications for MCC2 Antibody (NBP2-30804).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCC2 Antibody (NBP2-30804) (0)

There are no reviews for MCC2 Antibody (NBP2-30804). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MCC2 Antibody (NBP2-30804) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCC2 Products

MCC2 NBP2-30804

Bioinformatics Tool for MCC2 Antibody (NBP2-30804)

Discover related pathways, diseases and genes to MCC2 Antibody (NBP2-30804). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MCC2

There are no specific blogs for MCC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USHBP1
Uniprot