MBTPS1 Antibody (2E6.)

Images

 
Immunocytochemistry/ Immunofluorescence: MBTPS1 Antibody (2E6) [H00008720-M07] - Analysis of monoclonal antibody to MBTPS1 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: MBTPS1 Antibody (2E6.) [H00008720-M07] - MBTPS1 Antibody (2E6) [H00008720-M07] - Detection limit for recombinant GST tagged MBTPS1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
2E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MBTPS1 Antibody (2E6.) Summary

Immunogen
MBTPS1 (NP_957720.1 246 a.a. - 355 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDV
Specificity
Reacts with membrane-bound transcription factor peptidase, site 1.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MBTPS1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MBTPS1 Antibody (2E6.)

  • EC 3.4.21.112
  • Endopeptidase S1P
  • KIAA0091MGC138712
  • membrane-bound transcription factor peptidase, site 1
  • membrane-bound transcription factor protease, site 1
  • PCSK8
  • S1PMGC138711
  • site-1 protease
  • SKI1
  • SKI-1membrane-bound transcription factor site-1 protease
  • subtilisin/kexin isozyme-1
  • Subtilisin/kexin-isozyme 1

Background

The encoded protein has a central role in the regulation of lipid metabolism in cells. It is a sterol-regulated subtilisin-like serine protease that cleaves ER membrane-bound sterol regulatory element-binding proteins (SREBPs), a reaction that initiates the two-step proteolytic process by which transcriptionally active fragments of SREBPs are released from the membrane for translocation to the nucleus. The gene product is an integral membrane ER protein, with the bulk located in the ER lumen. It is synthesized as an inactive preproprotein that is self-activated by an intramolecular cleavage that generates the mature protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
H00008877-M01
Species: Hu
Applications: WB, ELISA
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-24762
Species: Hu, Mu
Applications: WB, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-26691
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-52567
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-57340
Species: Hu
Applications: ICC/IF
NBP1-33470
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF

Publications for MBTPS1 Antibody (H00008720-M07) (0)

There are no publications for MBTPS1 Antibody (H00008720-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBTPS1 Antibody (H00008720-M07) (0)

There are no reviews for MBTPS1 Antibody (H00008720-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MBTPS1 Antibody (H00008720-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MBTPS1 Products

Bioinformatics Tool for MBTPS1 Antibody (H00008720-M07)

Discover related pathways, diseases and genes to MBTPS1 Antibody (H00008720-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MBTPS1 Antibody (H00008720-M07)

Discover more about diseases related to MBTPS1 Antibody (H00008720-M07).
 

Pathways for MBTPS1 Antibody (H00008720-M07)

View related products by pathway.

PTMs for MBTPS1 Antibody (H00008720-M07)

Learn more about PTMs related to MBTPS1 Antibody (H00008720-M07).

Blogs on MBTPS1

There are no specific blogs for MBTPS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MBTPS1 Antibody (2E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol MBTPS1
Entrez