MBOAT2 Antibody - BSA Free

Western Blot: MBOAT2 Antibody [NBP2-83185] - Host: Rabbit. Target Name: Mboat2. Sample Type: Rat Thymus lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MBOAT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MBOAT2 Antibody - BSA Free (NBP2-83185) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat MBOAT2. Peptide sequence: GMFRKDEELTPSQRGLAVRRMPSLLEYVSYTCNFMGILAGPLCSYKDYIA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MBOAT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MBOAT2 Antibody - BSA Free

• 1-acylglycerophosphate O-acyltransferase
• EC 2.3.1.-
• EC 2.3.1.51
• EC 2.3.1.n7,1-acylglycerophosphoethanolamine O-acyltransferase
• FLJ14415
• FLJ90298
• LPAAT
• LPCAT4
• LPEAT
• LPLAT 2
• Lyso-PA acyltransferase
• Lyso-PE acyltransferase
• Lysophosphatidic acid acyltransferase
• Lysophosphatidylethanolamine acyltransferase
• lysophospholipid acyltransferase 2
• membrane bound O-acyltransferase domain containing 2
• Membrane-bound O-acyltransferase domain-containing protein 2
• OACT2
• O-acyltransferase (membrane bound) domain containing 2
• O-acyltransferase domain-containing protein 2

Background

Acyltransferase which mediates the conversion of lysophosphatidylethanolamine(1-acyl-sn-glycero-3-phosphoethanolamine or LPE) into phosphatidylethanolamine(1,2-diacyl-sn-glycero-3-phosphoethanolamine or PE) (LPEAT activity). Catalyzes also the acylation of lysophosphatidicacid (LPA) into phosphatidic acid (PA) (LPAAT activity). Has also a very weak lysophosphatidylcholine acyltransferase(LPCAT activity). Prefers oleoyl-CoA as the acyl donor. Lysophospholipid acyltransferases (LPLATs) catalyze thereacylation step of the phospholipid remodeling pathway also known as the Lands cycle

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MBOAT2