AGPAT2 Antibody - BSA Free

Western Blot: AGPAT2 Antibody [NBP1-88499] - Analysis in control (vector only transfected HEK293T lysate) and AGPAT2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: AGPAT2 Antibody [NBP1-88499] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AGPAT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AGPAT2 Antibody - BSA Free (NBP1-88499) is a polyclonal antibody validated for use in IHC, WB and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AGPAT2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Simple Western 1:100
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  AGPAT2 Protein (NBP1-88499PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AGPAT2 Antibody - BSA Free

• 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acidacyltransferase, beta)
• 1-acylglycerol-3-phosphate O-acyltransferase 2
• 1-AGPAT 2,1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acidacyltransferase-beta)
• 1-AGPAT2,1-AGP acyltransferase 2,1-acyl-sn-glycerol-3-phosphate acyltransferase beta
• Berardinelli-Seip congenital lipodystrophy
• BSCL
• BSCL1
• EC 2.3.1.51
• LPAAB
• LPAAT-beta
• Lysophosphatidic acid acyltransferase beta
• lysophosphatidic acid acyltransferase-beta

Background

AGPAT2 encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AGPAT2
• Entrez:
  • 10555(Human)
• Uniprot:
  • O15120(Human)