AGPAT2 Antibody

Images

 
Immunohistochemistry-Paraffin: AGPAT2 Antibody [NBP1-88499] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AGPAT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGPAT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:20
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AGPAT2 Protein (NBP1-88499PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AGPAT2 Antibody

  • 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acidacyltransferase, beta)
  • 1-acylglycerol-3-phosphate O-acyltransferase 2
  • 1-AGPAT 2,1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acidacyltransferase-beta)
  • 1-AGPAT2,1-AGP acyltransferase 2,1-acyl-sn-glycerol-3-phosphate acyltransferase beta
  • Berardinelli-Seip congenital lipodystrophy
  • BSCL
  • BSCL1
  • EC 2.3.1.51
  • LPAAB
  • LPAAT-beta
  • Lysophosphatidic acid acyltransferase beta
  • lysophosphatidic acid acyltransferase-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7385
Species: Hu
Applications: WB, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-82236
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57898
Species: Hu
Applications: WB, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-2387
Species: Hu, Mu, Ze
Applications: WB, ICC/IF

Publications for AGPAT2 Antibody (NBP1-88499) (0)

There are no publications for AGPAT2 Antibody (NBP1-88499).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGPAT2 Antibody (NBP1-88499) (0)

There are no reviews for AGPAT2 Antibody (NBP1-88499). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AGPAT2 Antibody (NBP1-88499) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AGPAT2 Products

Bioinformatics Tool for AGPAT2 Antibody (NBP1-88499)

Discover related pathways, diseases and genes to AGPAT2 Antibody (NBP1-88499). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGPAT2 Antibody (NBP1-88499)

Discover more about diseases related to AGPAT2 Antibody (NBP1-88499).
 

Pathways for AGPAT2 Antibody (NBP1-88499)

View related products by pathway.

PTMs for AGPAT2 Antibody (NBP1-88499)

Learn more about PTMs related to AGPAT2 Antibody (NBP1-88499).

Blogs on AGPAT2

There are no specific blogs for AGPAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AGPAT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGPAT2
Entrez
Uniprot