MBNL2 Antibody

Images

 
Western Blot: MBNL2 Antibody [NBP2-87783] - Host: Rabbit. Target Name: MBNL2. Sample Tissue: Rat Brain. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MBNL2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of RAT MBNL2. Peptide sequence: IACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MBNL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MBNL2 Antibody

  • DKFZp781H1296
  • MBLL39Muscleblind-like protein 1
  • MBLLMGC120628
  • MGC120625
  • MGC120626
  • MLP1
  • muscleblind-like 2 (Drosophila)
  • muscleblind-like protein 2
  • Muscleblind-like protein-like 39
  • Muscleblind-like protein-like
  • PRO2032

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004154-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB6967
Species: Hu
Applications: WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85635
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-42632
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86562
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
NBP1-06983
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
NBP2-92461
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-19462
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-2866
Species: Hu
Applications: ICC/IF, IP, KD, WB
NB120-11197
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB200-316
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-83213
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-56590
Species: Hu, Rt
Applications: IF, IHC, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-85519
Species: Hu, Mu
Applications: ELISA, IHC, IP, KD, WB
NBP2-87783
Species: Rt
Applications: WB

Publications for MBNL2 Antibody (NBP2-87783) (0)

There are no publications for MBNL2 Antibody (NBP2-87783).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBNL2 Antibody (NBP2-87783) (0)

There are no reviews for MBNL2 Antibody (NBP2-87783). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MBNL2 Antibody (NBP2-87783) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MBNL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MBNL2