Recombinant Human MAX binding protein Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MAX binding protein Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 473 - 582 of Human MNT partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SAPSPAVQLAPATPPIGHITVHPATLNHVAHLGSQLPLYPQPVAVSHIAHTLSHQQVNGTAGLGPPATVMAKPAVGAQVVHHPQLVGQTVLNPVTMVTMPSFPVSTLKLA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MNT

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAX binding protein Protein

  • BHLHD3
  • bHLHd3Max-interacting protein
  • Class D basic helix-loop-helix protein 3
  • MAD6
  • MAX binding protein
  • MXD6
  • Myc antagonist MNT
  • Protein ROX
  • ROXmax-binding protein MNT

Background

MNT - MAX binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-793
Species: Hu
Applications: WB, PEP-ELISA
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-46060
Species: Hu
Applications: WB, IHC, IHC-P
AF4185
Species: Hu
Applications: ICC
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1116
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready

Publications for MAX binding protein Partial Recombinant Protein (H00004335-Q01) (0)

There are no publications for MAX binding protein Partial Recombinant Protein (H00004335-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAX binding protein Partial Recombinant Protein (H00004335-Q01) (0)

There are no reviews for MAX binding protein Partial Recombinant Protein (H00004335-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAX binding protein Partial Recombinant Protein (H00004335-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAX binding protein Products

Bioinformatics Tool for MAX binding protein Partial Recombinant Protein (H00004335-Q01)

Discover related pathways, diseases and genes to MAX binding protein Partial Recombinant Protein (H00004335-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAX binding protein Partial Recombinant Protein (H00004335-Q01)

Discover more about diseases related to MAX binding protein Partial Recombinant Protein (H00004335-Q01).
 

Pathways for MAX binding protein Partial Recombinant Protein (H00004335-Q01)

View related products by pathway.

PTMs for MAX binding protein Partial Recombinant Protein (H00004335-Q01)

Learn more about PTMs related to MAX binding protein Partial Recombinant Protein (H00004335-Q01).
 

Research Areas for MAX binding protein Partial Recombinant Protein (H00004335-Q01)

Find related products by research area.

Blogs on MAX binding protein

There are no specific blogs for MAX binding protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAX binding protein Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MNT