Home » MASTL » MASTL Research Products » MASTL Recombinant Protein Antigen

MASTL Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MASTL Recombinant Protein Antigen (NBP2-55023PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

MASTL Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MASTL.

Source: E.coli

Amino Acid Sequence: EVLKTLASKRNAVAFRSFNSHINASNNSEPSRMNMTSLDAMDISCAYSGSYPMAITPTQKRRSCMPHQTPNQIKSG
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MASTL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55023 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for MASTL Recombinant Protein Antigen

  • FLJ14813EC 2.7.11.1
  • Greatwall
  • GW
  • GWL
  • hGWL
  • MASTL
  • MAST-L
  • microtubule associated serine/threonine kinase-like
  • Microtubule-associated serine/threonine-protein kinase-like
  • RP11-85G18.2
  • THC2
  • THC2greatwall protein kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
GW182 Antibody
NBP1-28751
GW182 Antibody [NBP1-28751] - Detection of human GW182 by western blot of immunoprecipitates. Samples: Whole cell lysate (50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-GW182 antibodyNBP1-28751 (lot NBP1-28751-2) used for IP at 6 ug/mg lysate. GW182 was also immunoprecipitated by a previous lot (lot NBP1-28751-1) of this antibody. For blotting immunoprecipitated GW182, NBP1-28751 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.
Knockdown Validated: GW182 Antibody [NBP1-28751] - Downregulation of eIF4E2 increases the protein levels of endogenous IMP1. HeLa cells were transfected with siRNAs indicated. At 48 h posttransfection, cells were lysed. A fraction of the lysate was subjected to SDS-PAGE followed by Western blotting. Image collected and cropped by CiteAb from the following publication (link.springer.com/10.1007/s13238-017-0444-0), licensed under a CC-BY licence.
Western Blot: GW182 Antibody [NBP1-28751] - Detection of Human GW182 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and Jurkat cells. Antibodies: Affinity purified rabbit anti-GW182 antibody NBP1-28751 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(11 Publications)
Species: Hu, Mu
Applications: IB, IP, KD, WB
CDC2/CDK1 Antibody
NBP1-85729
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining in human tonsil and pancreas tissues . Corresponding CDK1 RNA-seq data are presented for the same tissues.
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in human cell line A-431.
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PPAR alpha/NR1C1
Antibody
NB600-636
Immunocytochemistry/Immunofluorescence: PPAR alpha/NR1C1 Antibody [NB600-636] - Tissue: HepG2 cells. Fixation: 4% formaldehyde fixed (10 min). Antigen retrieval: not required. Primary antibody: PPAR alpha antibody at 1 ug/mL overnight at 4C. Secondary antibody: Alexa Fluor 488 goat anti-rabbit IgG (H+L) (green) used at a 1:1000, Alexa Fluor 594 WGA was used to label plasma membranes (red) at a 1:200 dilution for 1h for 45 min at RT. Localization: PPAR alpha is nuclear and occasionally cytoplasmic. Staining: PPAR alpha as green fluorescent signal with DAPI (blue) nuclear counterstain.
Western Blot: PPAR alpha/NR1C1 Antibody [NB600-636] - Affinity Purified Detection a 52 kDa band corresponding to PPAR alpha present in a 3T3 whole cell lysate. Approximately 20 ug of lysate was loaded per lane for SDS-PAGE. Detection occurred after using a 1:500 (lane 1) or 1:1000 (lane 2) dilution of antibody followed by 1:2000 dilution of HRP Goat-a-Rabbit IgG for visualization. Storage Conditions: Store vial at -20 C prior to opening. Dilute only prior to immediate use. For extended storage aliquot contents and freeze at -20 C or below. Avoid cycles of freezing and thawing. Expiration date is one (1) year from date of opening.
Immunohistochemistry: PPAR alpha/NR1C1 Antibody [NB600-636] - Photomicrographs of cryosections of canine cervical (C8) dorsal root ganglion showing PPARalpha (h-i) immunolabeling. White arrows indicate the Neurotrace labeled nuclei of SGCs which showed PPARalpha immunoreactivity (h). Open arrow indicate autofluorescent pigment. Bar: a-i = 50 um. Image collected and cropped by CiteAb from the following publication (https://www.frontiersin.org/article/10.3389/fvets.2019.00313/full) licensed under a CC-BY licence.
(18 Publications)
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
PPP2R4 Antibody
NBP1-87232
Western Blot: PPP2R4 Antibody [NBP1-87232] - Analysis in human cell line SiHa.
Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-87232] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA/CF
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA/CF) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(702 Publications)
Species: Hu
Applications: BA
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Flow Cytometry: PCNA Antibody (PC10) [NB500-106] - An intracellular stain was performed on HepG2 cells with PCNA Antibody (PC10) NB500-106G (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 488.
(37 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Raf-1 Antibody
(563002)
MAB4540
Western blot shows lysates of MCF‑7 human breast cancer cell line, HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, L‑929 mouse fibroblast cell line, and NRK rat normal kidney cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Raf‑1 at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Raf‑1 was detected in immersion fixed paraffin-embedded sections of human liver array using Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, WB
FBXW7/Cdc4
Antibody (3D1)
H00055294-M02
Sandwich ELISA: FBXW7/Cdc4 Antibody (3D1) [H00055294-M02] - Detection limit for recombinant GST tagged FBXW7 is approximately 0.1ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: FBXW7/Cdc4 Antibody (3D1) [H00055294-M02] - Analysis of monoclonal antibody to FBXW7 on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml.
(10 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.
Western Blot: iNOS Antibody [NB300-605] - LCA-induced oxidative stress in 4T1 breast cancer cells. The 4T1 cells were treated with LCA for 48 h, then the indicated measurements were performed. The level of iNOS protein was detected by western blotting (n = 3). Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2072-6694/11/9/1255), licensed under a CC-BY licence.
Western Blot: iNOS Antibody [NB300-605] - iNOS in stimulated astrocytes. Western blot image submitted by a verified customer review.
(79 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
DDX6 Antibody
NB200-191
Immunoprecipitation: DDX6 Antibody [NB200-191] - Detection of human DDX6 by Western Blot and Immunoprecipitation. Samples: Whole cell lysate (15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-DDX6 antibody NB200-191 used at 0.04 ug/ml for WB (A and B) and at 3 ug/mg lysate for IP. DDX6 was also immunoprecipitated using rabbit anti-DDX6 antibody NB200-192, but not with 'DDX6 Ab', which is to another epitope from DDX6. Normal rabbit IgG was used as a negative control. Detection: Chemiluminescence with an exposure time of 1 second (A & B).
Immunohistochemistry-Paraffin: DDX6 Antibody [NB200-191] - Section of human colon carcinoma (left) and mouse renal cell carcinoma(right). Antibody: Affinity purified rabbit anti-DDX6 used at a dilution of 1:200 (1ug/ml). Detection: DAB.
Immunocytochemistry/Immunofluorescence: DDX6 Antibody [NB200-191] - In normal condition, cells were fixed and stained for DDX6, that usually punctuate in process bodies (PBs). Primary Antibody rabbit-anti-DDX6 diluted 1:1000. Image submitted by a verified customer review.
(38 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(13 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
IL-6 [HRP]
D6050
(32 Reviews)
(589 Publications)
Species: Hu
Applications: ELISA
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Mesothelin
Antibody (MSLN/2131)
NBP2-79724
Immunohistochemistry-Paraffin: Mesothelin Antibody (MSLN/2131) [NBP2-79724] - Formalin-fixed, paraffin-embedded human Lung Mesothelioma stained with Mesothelin Antibody (MSLN/2131).
Immunohistochemistry-Paraffin: Mesothelin Antibody (MSLN/2131) [NBP2-79724] - Formalin-fixed, paraffin-embedded human Endometrial Carcinoma stained with Mesothelin Antibody (MSLN/2131).
Immunohistochemistry-Paraffin: Mesothelin Antibody (MSLN/2131) [NBP2-79724] - Formalin-fixed, paraffin-embedded human Tonsil stained with Mesothelin Antibody (MSLN/2131).
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PA
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(4 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - An intracellular stain was performed on Jurkat cells with GR/NR3C1 (BuGR2) antibody NB300-731PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerthrin.
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on HeLa cells with GR/NR3C1 (BuGR2) antibody NB300-731AF647 (blue) and a matched isotype control NB600-986AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunocytochemistry/Immunofluorescence: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of Glucocorticoid Receptor using Glucocorticoid Receptor Monoclonal Antibody (BuGR2) shows staining in A549 Cells. Glucocorticoid Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucocorticoid Receptor at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(17 Publications)
Species: Hu
Applications: BA
MASTL Recombinant
Protein Antigen
NBP2-55023PEP
MASTL Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MASTL Recombinant Protein Antigen (NBP2-55023PEP) (0)

There are no publications for MASTL Recombinant Protein Antigen (NBP2-55023PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MASTL Recombinant Protein Antigen (NBP2-55023PEP) (0)

There are no reviews for MASTL Recombinant Protein Antigen (NBP2-55023PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MASTL Recombinant Protein Antigen (NBP2-55023PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MASTL Products

Bioinformatics Tool for MASTL Recombinant Protein Antigen (NBP2-55023PEP)

Discover related pathways, diseases and genes to MASTL Recombinant Protein Antigen (NBP2-55023PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MASTL Recombinant Protein Antigen (NBP2-55023PEP)

Discover more about diseases related to MASTL Recombinant Protein Antigen (NBP2-55023PEP).
 

Pathways for MASTL Recombinant Protein Antigen (NBP2-55023PEP)

View related products by pathway.

PTMs for MASTL Recombinant Protein Antigen (NBP2-55023PEP)

Learn more about PTMs related to MASTL Recombinant Protein Antigen (NBP2-55023PEP).
 

Research Areas for MASTL Recombinant Protein Antigen (NBP2-55023PEP)

Find related products by research area.

Blogs on MASTL

There are no specific blogs for MASTL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-6 [HRP]
IL-6 [HRP]
D6050

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MASTL Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MASTL