Mas Antibody - BSA Free

Immunohistochemistry-Paraffin: Mas Antibody [NBP3-17188] - Staining of human colon shows strong membranous positivity in endothelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Mas Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Mas Antibody - BSA Free (NBP3-17188) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SKKKRFKESLKVVLTRAFKDEMQPRRQKDNCNTVTVETVV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Mas Antibody - BSA Free

• Mas
• MAS1 oncogene
• MAS1
• MGC119966
• proto-oncogene Mas

Background

The MAS1 product is highly similar to other MRG receptors. This receptor has been suggested to affect the blood pressure control and body fluid homeostasis in the renin-angiotensis system. Mas proto-oncogene has been reported in brain, breast, eye, heart, kidney, and testis. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth regulating pathway to bring about oncogenic effects.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAS1