MARK4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MARK4 Antibody [NBP1-83442] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: MARK4 Antibody [NBP1-83442] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MARK4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSDTTNGTSSSKGTSHSKGQRSSSSTYHRQRRHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MARK4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MARK4 Protein (NBP1-83442PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MARK4 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ12177
  • FLJ90097
  • KIAA1860MARK4L
  • MAP/microtubule affinity-regulating kinase 4
  • MAP/microtubule affinity-regulating kinase like 1
  • MAP/microtubule affinity-regulating kinase-like 1
  • MARK4 serine/threonine protein kinase
  • MARKL1L
  • MARKL1MARK4S
  • Nbla00650

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33409
Species: Hu
Applications: WB, ICC/IF
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
NBP2-37445
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB6978
Species: Hu, Mu, Rt
Applications: WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-56690
Species: Hu
Applications: ICC/IF
NBP1-97856
Species: Hu, Mu, Rt
Applications: WB
NBP2-47278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56458
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB
NBP2-55573
Species: Hu
Applications: ICC/IF
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-83442
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for MARK4 Antibody (NBP1-83442) (0)

There are no publications for MARK4 Antibody (NBP1-83442).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MARK4 Antibody (NBP1-83442) (0)

There are no reviews for MARK4 Antibody (NBP1-83442). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MARK4 Antibody (NBP1-83442) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MARK4 Products

Bioinformatics Tool for MARK4 Antibody (NBP1-83442)

Discover related pathways, diseases and genes to MARK4 Antibody (NBP1-83442). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MARK4 Antibody (NBP1-83442)

Discover more about diseases related to MARK4 Antibody (NBP1-83442).
 

Pathways for MARK4 Antibody (NBP1-83442)

View related products by pathway.

PTMs for MARK4 Antibody (NBP1-83442)

Learn more about PTMs related to MARK4 Antibody (NBP1-83442).
 

Research Areas for MARK4 Antibody (NBP1-83442)

Find related products by research area.

Blogs on MARK4

There are no specific blogs for MARK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MARK4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MARK4