MARK1 Antibody

Images

 
Immunohistochemistry-Paraffin: MARK1 Antibody [NBP1-82800] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MARK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHGEQLRERRSVAYNGPPASPSHETGAFAHARRGTSTGIISKIT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MARK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MARK1 Protein (NBP1-82800PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MARK1 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA1477serine/threonine-protein kinase MARK1
  • MAP/microtubule affinity-regulating kinase 1MGC126512
  • MARKMGC126513

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-37445
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49382
Species: Hu
Applications: IHC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
AF3795
Species: Hu
Applications: WB, IP
NBP2-45755
Species: Hu
Applications: WB, IHC
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89483
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for MARK1 Antibody (NBP1-82800) (0)

There are no publications for MARK1 Antibody (NBP1-82800).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MARK1 Antibody (NBP1-82800) (0)

There are no reviews for MARK1 Antibody (NBP1-82800). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MARK1 Antibody (NBP1-82800) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MARK1 Products

Bioinformatics Tool for MARK1 Antibody (NBP1-82800)

Discover related pathways, diseases and genes to MARK1 Antibody (NBP1-82800). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MARK1 Antibody (NBP1-82800)

Discover more about diseases related to MARK1 Antibody (NBP1-82800).
 

Pathways for MARK1 Antibody (NBP1-82800)

View related products by pathway.

PTMs for MARK1 Antibody (NBP1-82800)

Learn more about PTMs related to MARK1 Antibody (NBP1-82800).
 

Research Areas for MARK1 Antibody (NBP1-82800)

Find related products by research area.

Blogs on MARK1

There are no specific blogs for MARK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MARK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MARK1