MAP1B Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: MAP1B Antibody [NBP1-81261] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP1-81261 antibody. Corresponding MAP1B RNA-seq data are ...read more
Genetic Strategies: Western Blot: MAP1B Antibody [NBP1-81261] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MAP1B antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: MAP1B Antibody [NBP1-81261] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: MAP1B Antibody [NBP1-81261] - Staining of human cerebellum shows moderate to strong membranous positivity in cells in granular layer.
Immunohistochemistry-Paraffin: MAP1B Antibody [NBP1-81261] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: MAP1B Antibody [NBP1-81261] - Staining of human skeletal muscle shows low positivity in myocytes as expected.
Immunohistochemistry-Paraffin: MAP1B Antibody [NBP1-81261] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAP1B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTST
Marker
Neuronal Marker
Specificity
Specificity of human MAP1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAP1B Recombinant Protein Antigen (NBP1-81261PEP)
Publications
Read Publications using
NBP1-81261 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%). Reactivity reported in scientific literature (PMID: 23227862)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAP1B Antibody

  • DKFZp686E1099
  • DKFZp686F1345
  • FLJ38954
  • FUTSCH
  • MAP-1B
  • MAP5
  • microtubule-associated protein 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KD
NBP2-80467
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
NBP2-32630
Species: Hu
Applications: IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3537
Species: Hu
Applications: WB, IP
NBP2-01770
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00064112-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47281
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67514
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB300-135
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, IHC-WhMt
NB300-653
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for MAP1B Antibody (NBP1-81261)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MAP1B Antibody (NBP1-81261) (0)

There are no reviews for MAP1B Antibody (NBP1-81261). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAP1B Antibody (NBP1-81261) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAP1B Products

Array NBP1-81261

Bioinformatics Tool for MAP1B Antibody (NBP1-81261)

Discover related pathways, diseases and genes to MAP1B Antibody (NBP1-81261). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP1B Antibody (NBP1-81261)

Discover more about diseases related to MAP1B Antibody (NBP1-81261).
 

Pathways for MAP1B Antibody (NBP1-81261)

View related products by pathway.

PTMs for MAP1B Antibody (NBP1-81261)

Learn more about PTMs related to MAP1B Antibody (NBP1-81261).

Blogs on MAP1B.

Why LC3B Antibodies Make Ideal Autophagosomes Membrane Markers
The human form of microtubule-associated protein light chain 3 (LC3) is expressed as 3 splice variants; LC3A, LC3B and LC3C (He et al., 2003). LC3B is a subunit of the MAP1A and MAP1B microtubule-binding pr...  Read full blog post.

SuperBUGS in the Brain: MAP1B Antibodies & Neuronal Disease Research
Recently, we at Novus Biologicals added a new phospho-MAP1B (phosphorylated microtubule-associated protein 1B) antibody to our antibody database. MAP1B is a developmentally regulated phosphoprotein thought to be involved in the assembly of microtubule...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP1B