MANEA Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MANEA Antibody [NBP1-82279] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: MANEA Antibody [NBP1-82279] - Staining of human testis.
Immunohistochemistry-Paraffin: MANEA Antibody [NBP1-82279] - Staining of human lymph node shows moderate positivity in non-germinal center cells.
Independent Antibodies: Immunohistochemistry-Paraffin: MANEA Antibody [NBP1-82279] - Staining of human colon, kidney, liver and testis using Anti-MANEA antibody NBP1-82279 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: MANEA Antibody [NBP1-82279] - Staining of human colon.
Immunohistochemistry-Paraffin: MANEA Antibody [NBP1-82279] - Staining of human liver.
Immunohistochemistry-Paraffin: MANEA Antibody [NBP1-82279] - Staining of human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

MANEA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LRPNTATFGAPFGLDLLPELHQRTIHLGKNFDFQKSDRINSETNTKNLKSVEITMKPSKASELNLDELPPLNNYLHVFYYSWYGNPQFDGKYIHWNHPVLEHWDPRIAKNYPQGRHNPPDDIGSSFYPELGSYSSRD
Specificity
Specificity of human MANEA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MANEA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MANEA Recombinant Protein Antigen (NBP1-82279PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MANEA Antibody

  • alpha 1,2-endomannosidase
  • DKFZp686D20120
  • EC 3.2.1
  • EC 3.2.1.130
  • ENDO
  • Endo-alpha mannosidase
  • endomannosidase
  • FLJ12838
  • glycoprotein endo-alpha-1,2-mannosidase
  • hEndo
  • mandaselin
  • mannosidase, endo-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83792
Species: Hu
Applications: IHC, IHC-P
DTFP10
Species: Hu
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NB100-106
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-23368
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for MANEA Antibody (NBP1-82279) (0)

There are no publications for MANEA Antibody (NBP1-82279).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MANEA Antibody (NBP1-82279) (0)

There are no reviews for MANEA Antibody (NBP1-82279). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MANEA Antibody (NBP1-82279) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MANEA Products

Bioinformatics Tool for MANEA Antibody (NBP1-82279)

Discover related pathways, diseases and genes to MANEA Antibody (NBP1-82279). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MANEA Antibody (NBP1-82279)

Discover more about diseases related to MANEA Antibody (NBP1-82279).
 

Pathways for MANEA Antibody (NBP1-82279)

View related products by pathway.

Research Areas for MANEA Antibody (NBP1-82279)

Find related products by research area.

Blogs on MANEA

There are no specific blogs for MANEA, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MANEA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MANEA