NGLY1 Antibody

Images

 
Immunohistochemistry-Paraffin: NGLY1 Antibody [NBP1-83792] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NGLY1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ISDEDFLLLELLHWFKEEFFHWVNNVLCSKCGGQTRSRDRSLLPSDDELKWGAKEVEDHYCDACQFSNRFPRYNNPEKLLETRCGR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NGLY1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NGLY1 Protein (NBP1-83792PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NGLY1 Antibody

  • EC 3.5.1.52
  • hPNGase
  • N-glycanase 1FLJ12409
  • peptide:N-glycanase
  • peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase
  • PNG1FLJ11005
  • PNGase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82279
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF4409
Species: Mu
Applications: WB
NBP2-45514
Species: Hu
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27184
Species: Hu, Mu, Ca, Eq
Applications: WB, ICC/IF
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-10680
Species: Hu
NBP1-83792
Species: Hu
Applications: IHC, IHC-P

Publications for NGLY1 Antibody (NBP1-83792) (0)

There are no publications for NGLY1 Antibody (NBP1-83792).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NGLY1 Antibody (NBP1-83792) (0)

There are no reviews for NGLY1 Antibody (NBP1-83792). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NGLY1 Antibody (NBP1-83792) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NGLY1 Products

Bioinformatics Tool for NGLY1 Antibody (NBP1-83792)

Discover related pathways, diseases and genes to NGLY1 Antibody (NBP1-83792). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NGLY1 Antibody (NBP1-83792)

Discover more about diseases related to NGLY1 Antibody (NBP1-83792).

Blogs on NGLY1

There are no specific blogs for NGLY1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NGLY1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NGLY1