MAN2C1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MAN2C1 Antibody [NBP2-57246] - Staining of human cell line HEK 293 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MAN2C1 Antibody [NBP2-57246] - Immunohistochemical staining of human fallopian tube shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAN2C1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGKDNQRSFQALYTANQMVNVCDPAQPETFPVAQALASRFFGQHGGESQHTIHATGHCHIDTAWLWPFKETVRKCARSWVTALQLMERNP
Specificity
Specificity of human MAN2C1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAN2C1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAN2C1 Recombinant Protein Antigen (NBP2-57246PEP)

Reactivity Notes

Mouse 84%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MAN2C1 Antibody

  • Alpha mannosidase 6A8B
  • Alpha-D-mannoside mannohydrolase
  • alpha-mannosidase 2C1
  • DKFZp686E23167
  • EC 3.2.1.24
  • MAN6A8
  • MANA1
  • MANAMGC87979
  • Mannosidase alpha class 2C member 1
  • mannosidase, alpha 6A8
  • mannosidase, alpha A, cytoplasmic
  • mannosidase, alpha, class 2C, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP3-04803
Species: Hu, Mu
Applications: WB, IHC
NBP2-93465
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-57753
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00004125-D01P
Species: Hu
Applications: WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89284
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-83357
Species: Hu
Applications: WB, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: All-NA
Applications: WB, IHC, IHC-P
NBP2-75626
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
AF7865
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-57246
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MAN2C1 Antibody (NBP2-57246) (0)

There are no publications for MAN2C1 Antibody (NBP2-57246).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAN2C1 Antibody (NBP2-57246) (0)

There are no reviews for MAN2C1 Antibody (NBP2-57246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAN2C1 Antibody (NBP2-57246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAN2C1 Products

Bioinformatics Tool for MAN2C1 Antibody (NBP2-57246)

Discover related pathways, diseases and genes to MAN2C1 Antibody (NBP2-57246). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAN2C1 Antibody (NBP2-57246)

Discover more about diseases related to MAN2C1 Antibody (NBP2-57246).
 

Pathways for MAN2C1 Antibody (NBP2-57246)

View related products by pathway.

PTMs for MAN2C1 Antibody (NBP2-57246)

Learn more about PTMs related to MAN2C1 Antibody (NBP2-57246).

Blogs on MAN2C1

There are no specific blogs for MAN2C1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAN2C1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAN2C1