MAN1C1 Antibody

Immunohistochemistry-Paraffin: MAN1C1 Antibody [NBP2-14217] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: MAN1C1 Antibody [NBP2-14217] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: MAN1C1 Antibody [NBP2-14217] - Staining of human Kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: MAN1C1 Antibody [NBP2-14217] - Staining of human Testis shows strong granular cytoplasmic positivity in Leydig cells.

Product Discontinued

MAN1C1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QSQVRAQREKIKEMMQFAWQSYKRYAMGKNELRPLTKDGYEGNMFGGLSGATVIDSLDTLYLMELKEEFQEAKAWVGESFHLNVSG
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAN1C1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MAN1C1 Antibody

• 1,2-alpha-mannosidase IC
• Alpha-1,2-mannosidase IC
• EC 3.2.1.113
• HMICProcessing alpha-1,2-mannosidase IC
• MAN1A3
• MAN1C
• Mannosidase alpha class 1C member 1
• mannosidase, alpha, class 1C, member 1
• mannosyl-oligosaccharide 1,2-alpha-mannosidase IC
• pp6318

Background

Mannosidases are divided into two subtypes; I and II, (EC numbers 3.2.1.113 and 3.2.1.114 respectively) which display awide expression pattern. Mannosidase I hydrolyzes (1,2)-linked alpha-D-mannose residues in the oligo-mannoseoligosaccharide Man9(GlcNAc)2 and mannosidase II hydrolyzes (1,3)- and (1,6)-linked alpha-D-mannose residues inMan5(GlcNAc)3. Both subtypes require a divalent cation cofactor. Mutations in mannosidases can cause mannosidosis(mannosidase I deficiency).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MAN1C1 Antibody (NBP2-14217)(1)

Publication using NBP2-14217

• Ladaigue S, Lefranc AC, Balde K et al. A role for endothelial alpha-mannosidase MAN1C1 in radiation-induced immune cell recruitment iScience 2022-12-22 [PMID: 36404925] (Block/Neutralize)

Bioinformatics

• Gene Symbol: MAN1C1