MAMSTR Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MAMSTR Antibody [NBP2-56221] - Staining of human cell line U-2 OS shows localization to nuclear speckles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAMSTR Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPGPSLWEGTDSQQPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAMSTR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MAMSTR Recombinant Protein Antigen (NBP2-56221PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MAMSTR Antibody - BSA Free

• FLJ36070
• MASTRlikely ortholog of MEF2-activating SAP transcriptional regulator
• MEF2 activating motif and SAP domain containing transcriptional regulator
• MEF2-activating motif and SAP domain-containing transcriptional regulator
• MEF2-activating SAP transcriptional regulator
• MEF2-activating SAP transcriptional regulatory protein
• MGC117259

Background

Transcriptional coactivator. Stimulates the transcriptional activity of MEF2C. Stimulates MYOD1 activity inpart via MEF2, resulting in an enhancement of skeletal muscle differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAMSTR