Mammaglobin B Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SCGB2A1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Mammaglobin B Antibody - BSA Free
Background
Secretoglobins (also called lipophilins or mammaglobins) are small secreted proteins of endocrine-responsive organs and mucosal epithelia that form multimeric complexes and correlate with the development of various human cancers. Lipophilin A and Lipophilin B are orthologs of prostatein (estramustine- binding protein), the major secretory glycoprotein of the rat ventral prostate gland. Lipophilin A, also designated LIPA, LPHA and secretoglobin, family 1D, member 1 (SCGB1D1), is a component of a heterodimeric molecule present in human tears. Lipophilin B, also designated LIPB, LPHB and secretoglobin, family 1D, member 2 (SCGB1D2), mRNA can be overexpressed in breast tumors and shows a high degree of correlation with the mRNA expression profile of mammaglobin. Histological detection in breast tissue of Mammaglobin A, also designated MGB1 and secretoglobin, family 2A, member 2 (SCGB2A2) and Mammaglobin B, also designated MGB2, Lipophilin C, LPHC, UGB3 and SCGB2A2, is a reliable diagnostic marker for breast tumors
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for Mammaglobin B Antibody (NBP1-87736) (0)
There are no publications for Mammaglobin B Antibody (NBP1-87736).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Mammaglobin B Antibody (NBP1-87736) (0)
There are no reviews for Mammaglobin B Antibody (NBP1-87736).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Mammaglobin B Antibody (NBP1-87736) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Mammaglobin B Products
Research Areas for Mammaglobin B Antibody (NBP1-87736)
Find related products by research area.
|
Blogs on Mammaglobin B