SCGB1D2 Antibody


Immunohistochemistry: SCGB1D2 Antibody [NBP1-81304] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

SCGB1D2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:FCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCS
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
SCGB1D2 Protein (NBP1-81304PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SCGB1D2 Antibody

  • LIPB
  • lipophilin-B
  • LPHB
  • prostatein-like lipophilin B
  • secretoglobin family 1D member 2
  • secretoglobin, family 1D, member 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for SCGB1D2 Antibody (NBP1-81304) (0)

There are no publications for SCGB1D2 Antibody (NBP1-81304).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCGB1D2 Antibody (NBP1-81304) (0)

There are no reviews for SCGB1D2 Antibody (NBP1-81304). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SCGB1D2 Antibody (NBP1-81304) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SCGB1D2 Antibody Products

SCGB1D2 NBP1-81304

Related Products by Gene

Bioinformatics Tool for SCGB1D2 Antibody (NBP1-81304)

Discover related pathways, diseases and genes to SCGB1D2 Antibody (NBP1-81304). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCGB1D2 Antibody (NBP1-81304)

Discover more about diseases related to SCGB1D2 Antibody (NBP1-81304).

Pathways for SCGB1D2 Antibody (NBP1-81304)

View related products by pathway.

PTMs for SCGB1D2 Antibody (NBP1-81304)

Learn more about PTMs related to SCGB1D2 Antibody (NBP1-81304).

Blogs on SCGB1D2

There are no specific blogs for SCGB1D2, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our SCGB1D2 Antibody and receive a gift card or discount.


Gene Symbol SCGB1D2

Customers Who Bought This Also Bought