SCGB1D2 Antibody

Images

 
Immunohistochemistry: SCGB1D2 Antibody [NBP1-81304] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

SCGB1D2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCGB1D2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
SCGB1D2 Protein (NBP1-81304PEP)

Alternate Names for SCGB1D2 Antibody

  • LIPB
  • LIPHB
  • lipophilin-B
  • LPHB
  • prostatein-like lipophilin B
  • secretoglobin family 1D member 2
  • secretoglobin, family 1D, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54155
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87736
Species: Hu
Applications: WB, IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF3465
Species: Mu
Applications: WB
H00023049-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB847
Species: Hu, Mu, Rt
Applications: WB, IHC, ICFlow
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-33688
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92073
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SCGB1D2 Antibody (NBP1-81304) (0)

There are no publications for SCGB1D2 Antibody (NBP1-81304).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCGB1D2 Antibody (NBP1-81304) (0)

There are no reviews for SCGB1D2 Antibody (NBP1-81304). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SCGB1D2 Antibody (NBP1-81304) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCGB1D2 Antibody Products

SCGB1D2 NBP1-81304

Related Products by Gene

Bioinformatics Tool for SCGB1D2 Antibody (NBP1-81304)

Discover related pathways, diseases and genes to SCGB1D2 Antibody (NBP1-81304). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCGB1D2 Antibody (NBP1-81304)

Discover more about diseases related to SCGB1D2 Antibody (NBP1-81304).
 

Pathways for SCGB1D2 Antibody (NBP1-81304)

View related products by pathway.

PTMs for SCGB1D2 Antibody (NBP1-81304)

Learn more about PTMs related to SCGB1D2 Antibody (NBP1-81304).

Blogs on SCGB1D2

There are no specific blogs for SCGB1D2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SCGB1D2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81304 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought