SCGB1D2 Antibody - BSA Free

Immunohistochemistry-Paraffin: SCGB1D2 Antibody [NBP1-81304] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: SCGB1D2 Antibody [NBP1-81304] - Staining of human cervix, uterine shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SCGB1D2 Antibody [NBP1-81304] - Staining of human breast shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SCGB1D2 Antibody [NBP1-81304] - Staining of human fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SCGB1D2 Antibody [NBP1-81304] - Staining of human prostate shows weak granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SCGB1D2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SCGB1D2 Antibody - BSA Free (NBP1-81304) is a polyclonal antibody validated for use in IHC. Anti-SCGB1D2 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCGB1D2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SCGB1D2 Protein (NBP1-81304PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SCGB1D2 Antibody - BSA Free

• LIPB
• LIPHB
• lipophilin-B
• LPHB
• prostatein-like lipophilin B
• secretoglobin family 1D member 2
• secretoglobin, family 1D, member 2

Background

The protein encoded by the SCGB1D2 gene is a member of the lipophilin subfamily, part of the uteroglobin superfamily, and is an ortholog of prostatein, the major secretory glycoprotein of the rat ventral prostate gland. Lipophilin gene products are widely expressed in normal tissues, especially in endocrine-responsive organs. Assuming that human lipophilins are the functional counterparts of prostatein, they may be transcriptionally regulated by steroid hormones, with the ability to bind androgens, other steroids and possibly bind and concentrate estramustine, a chemotherapeutic agent widely used for prostate cancer. Although the gene has been reported to be on chromosome 10, this sequence appears to be from a cluster of genes on chromosome 11 that includes mammaglobin 2. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SCGB1D2 Antibody (NBP1-81304)(3)

Publications using NBP1-81304

• Kartika ID, Kotani H, Iida Y Et al. Protective role of cytoplasmic p21Cip1/Waf1 in apoptosis of CDK4/6 inhibitor-induced senescence in breast cancer cells Cancer medicine 2021-11-11 [PMID: 34761877] (IHC-P)
• Gambichler T, Elfering J, Meyer T Et al. Protein expression of prognostic genes in primary melanoma and benign nevi Journal of cancer research and clinical oncology 2021-11-10 [PMID: 34757537] (IHC-P)
• Doebar S C, Sieuwerts A M et al. Gene Expression Differences between Ductal Carcinoma in Situ with and without Progression to Invasive Breast Cancer. Am J Pathol 2017-01-07 [PMID: 28634007] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: SCGB1D2