Mammaglobin B Antibody


Western Blot: Mammaglobin B Antibody [NBP1-87736] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate more
Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736] - Staining in human cervix, uterine and testis tissues using anti-SCGB2A1 antibody. Corresponding SCGB2A1 RNA-seq data are presented for the same more
Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736] - Staining of human cervix, uterine shows high expression.
Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736] - Staining of human testis shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Mammaglobin B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMK
Specificity of human Mammaglobin B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Mammaglobin B Protein (NBP1-87736PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Mammaglobin B Antibody

  • Lacryglobin
  • lipophilin C
  • Lipophilin-C
  • LPHC
  • mammaglobin 2
  • mammaglobin B
  • Mammaglobin-2
  • MGB2mammaglobin-B
  • MGC71973
  • Secretoglobin family 2A member 1
  • secretoglobin, family 2A, member 1
  • UGB3mammaglobin-2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Mammaglobin B Antibody (NBP1-87736) (0)

There are no publications for Mammaglobin B Antibody (NBP1-87736).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mammaglobin B Antibody (NBP1-87736) (0)

There are no reviews for Mammaglobin B Antibody (NBP1-87736). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mammaglobin B Antibody (NBP1-87736) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Mammaglobin B Products

Bioinformatics Tool for Mammaglobin B Antibody (NBP1-87736)

Discover related pathways, diseases and genes to Mammaglobin B Antibody (NBP1-87736). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mammaglobin B Antibody (NBP1-87736)

Discover more about diseases related to Mammaglobin B Antibody (NBP1-87736).

Pathways for Mammaglobin B Antibody (NBP1-87736)

View related products by pathway.

Blogs on Mammaglobin B

There are no specific blogs for Mammaglobin B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Mammaglobin B Antibody and receive a gift card or discount.


Gene Symbol SCGB2A1