Mammaglobin B Antibody

Images

 
Western Blot: Mammaglobin B Antibody [NBP1-87736] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736] - Staining of human cervix, uterine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Mammaglobin B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCGB2A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Mammaglobin B Protein (NBP1-87736PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mammaglobin B Antibody

  • Lacryglobin
  • LIPHC
  • lipophilin C
  • Lipophilin-C
  • LPHC
  • mammaglobin 2
  • mammaglobin B
  • Mammaglobin-2
  • MGB2mammaglobin-B
  • MGC71973
  • Secretoglobin family 2A member 1
  • secretoglobin, family 2A, member 1
  • UGB3mammaglobin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4218
Species: Hu
Applications: WB, IHC
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-81304
Species: Hu
Applications: IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF4478
Species: Hu
Applications: WB, IHC
AF3465
Species: Mu
Applications: WB
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00005670-T01
Species: Hu
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
H00091074-R01
Species: Hu
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87736
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Mammaglobin B Antibody (NBP1-87736) (0)

There are no publications for Mammaglobin B Antibody (NBP1-87736).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mammaglobin B Antibody (NBP1-87736) (0)

There are no reviews for Mammaglobin B Antibody (NBP1-87736). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mammaglobin B Antibody (NBP1-87736) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mammaglobin B Products

Bioinformatics Tool for Mammaglobin B Antibody (NBP1-87736)

Discover related pathways, diseases and genes to Mammaglobin B Antibody (NBP1-87736). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mammaglobin B Antibody (NBP1-87736)

Discover more about diseases related to Mammaglobin B Antibody (NBP1-87736).
 

Pathways for Mammaglobin B Antibody (NBP1-87736)

View related products by pathway.

Blogs on Mammaglobin B

There are no specific blogs for Mammaglobin B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mammaglobin B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCGB2A1