Mammaglobin B Antibody - BSA Free

Western Blot: Mammaglobin B Antibody [NBP1-87736] - Analysis in control (vector only transfected HEK293T lysate) and SCGB2A1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736] - Staining in human cervix, uterine and testis tissues using anti-SCGB2A1 antibody. Corresponding SCGB2A1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736] - Staining of human cervix, uterine shows high expression.

Immunohistochemistry-Paraffin: Mammaglobin B Antibody [NBP1-87736] - Staining of human testis shows low expression as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Mammaglobin B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Mammaglobin B Antibody - BSA Free (NBP1-87736) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCGB2A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Mammaglobin B Protein (NBP1-87736PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Mammaglobin B Antibody - BSA Free

• Lacryglobin
• LIPHC
• lipophilin C
• Lipophilin-C
• LPHC
• mammaglobin 2
• mammaglobin B
• Mammaglobin-2
• MGB2mammaglobin-B
• MGC71973
• Secretoglobin family 2A member 1
• secretoglobin, family 2A, member 1
• UGB3mammaglobin-2

Background

Secretoglobins (also called lipophilins or mammaglobins) are small secreted proteins of endocrine-responsive organs and mucosal epithelia that form multimeric complexes and correlate with the development of various human cancers. Lipophilin A and Lipophilin B are orthologs of prostatein (estramustine- binding protein), the major secretory glycoprotein of the rat ventral prostate gland. Lipophilin A, also designated LIPA, LPHA and secretoglobin, family 1D, member 1 (SCGB1D1), is a component of a heterodimeric molecule present in human tears. Lipophilin B, also designated LIPB, LPHB and secretoglobin, family 1D, member 2 (SCGB1D2), mRNA can be overexpressed in breast tumors and shows a high degree of correlation with the mRNA expression profile of mammaglobin. Histological detection in breast tissue of Mammaglobin A, also designated MGB1 and secretoglobin, family 2A, member 2 (SCGB2A2) and Mammaglobin B, also designated MGB2, Lipophilin C, LPHC, UGB3 and SCGB2A2, is a reliable diagnostic marker for breast tumors

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCGB2A1