MAML3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MAML3 Antibody [NBP1-86674] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: MAML3 Antibody [NBP1-86674] - Analysis in human endometrium and skeletal muscle tissues using NBP1-86674 antibody. Corresponding MAML3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MAML3 Antibody [NBP1-86674] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: MAML3 Antibody [NBP1-86674] - Staining of human Endometrium shows moderate nuclear positivity in stromal and glandular cells.

Immunohistochemistry-Paraffin: MAML3 Antibody [NBP1-86674] - Staining of human Cervix shows moderate nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: MAML3 Antibody [NBP1-86674] - Staining of human Lymph node shows moderate nuclear positivity in germinal center and non-germinal center cells.

Immunohistochemistry-Paraffin: MAML3 Antibody [NBP1-86674] - Staining of human Testis shows moderate nuclear positivity in cells in seminiferous ducts and Leydig cells.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAML3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MAML3 Antibody - BSA Free (NBP1-86674) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GVGMVSGFGQSMLVNSAITQQHPQMKGPVGQALPRPQAPPRLQSLMGTVQQGAQSWQQRSLQGMPGRTSGELGPFNNGASYPLQAGQPR
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAML3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MAML3 Protein (NBP1-86674PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MAML3 Antibody - BSA Free

• CAG/CTG 3
• ERDA3
• MAM-2
• mam-3
• mastermind-like 3 (Drosophila)
• mastermind-like protein 3
• polyglutamine rich
• trinucleotide repeat containing 3

Background

There are 3 MAML (mastermind-like) proteins in mammals (MAML1-3). MAML3 is a coactivator for NOTCH signaling. MAML3 associates with NOTCH and CSL in a ternary complex and functions to activate transcription of HES and hairy-related basic helix-loop-helix transcription factors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAML3