MAML3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MAML3 Antibody [NBP1-86674] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: MAML3 Antibody [NBP1-86674] - Staining of human rectum shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAML3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GVGMVSGFGQSMLVNSAITQQHPQMKGPVGQALPRPQAPPRLQSLMGTVQQGAQSWQQRSLQGMPGRTSGELGPFNNGASYPLQAGQPR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAML3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAML3 Protein (NBP1-86674PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAML3 Antibody

  • CAG/CTG 3
  • ERDA3
  • MAM-2
  • mam-3
  • mastermind-like 3 (Drosophila)
  • mastermind-like protein 3
  • polyglutamine rich
  • trinucleotide repeat containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

2980-PI
Species: Hu
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-47649
Species: Hu
Applications: WB, Flow, IHC-P, PAGE, IF
NBP1-33638
Species: Hu, Mu
Applications: WB, ICC/IF
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF4079
Species: Hu
Applications: WB, ICC
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP1-59312
Species: Hu
Applications: WB
NBP2-46231
Species: Hu
Applications: WB, IHC
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-56905
Species: Hu
Applications: WB, ICC/IF
AF4478
Species: Hu
Applications: WB, IHC
MAB8550
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
NBP1-86674
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for MAML3 Antibody (NBP1-86674) (0)

There are no publications for MAML3 Antibody (NBP1-86674).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAML3 Antibody (NBP1-86674) (0)

There are no reviews for MAML3 Antibody (NBP1-86674). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAML3 Antibody (NBP1-86674) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAML3 Products

Bioinformatics Tool for MAML3 Antibody (NBP1-86674)

Discover related pathways, diseases and genes to MAML3 Antibody (NBP1-86674). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAML3 Antibody (NBP1-86674)

Discover more about diseases related to MAML3 Antibody (NBP1-86674).
 

Pathways for MAML3 Antibody (NBP1-86674)

View related products by pathway.

PTMs for MAML3 Antibody (NBP1-86674)

Learn more about PTMs related to MAML3 Antibody (NBP1-86674).
 

Research Areas for MAML3 Antibody (NBP1-86674)

Find related products by research area.

Blogs on MAML3

There are no specific blogs for MAML3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAML3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAML3