MAML3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GVGMVSGFGQSMLVNSAITQQHPQMKGPVGQALPRPQAPPRLQSLMGTVQQGAQSWQQRSLQGMPGRTSGELGPFNNGASYPLQAGQPR |
| Predicted Species |
Mouse (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MAML3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:50-1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MAML3 Antibody - BSA Free
Background
There are 3 MAML (mastermind-like) proteins in mammals (MAML1-3). MAML3 is a coactivator for NOTCH signaling. MAML3 associates with NOTCH and CSL in a ternary complex and functions to activate transcription of HES and hairy-related basic helix-loop-helix transcription factors.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: InhibAct
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ChIP, ICC/IF, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Publications for MAML3 Antibody (NBP1-86674) (0)
There are no publications for MAML3 Antibody (NBP1-86674).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MAML3 Antibody (NBP1-86674) (0)
There are no reviews for MAML3 Antibody (NBP1-86674).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MAML3 Antibody (NBP1-86674) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MAML3 Products
Research Areas for MAML3 Antibody (NBP1-86674)
Find related products by research area.
|
Blogs on MAML3