Recombinant Human MAMDC2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MAMDC2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 232 of Human MAMDC2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQAEITFKKPMPTKVVFMSLCKSFWDCGLVALDDITIQLGSCSSSEKLPPPPGECTFEQDECTFTQEKRNRSSWHRRRGETPTSYTGPKGDHTTGVGYYMYIEASHMVYGQKARLLSRPLRGVSGKHCLTFFYHMYGGGTGLLSVYLKKEEDSEESLLWRRRGEQSISWLRALIEYSCERQHQIIFEAIRGVSIRSDIAIDDVKFQAGPCGEMEDTTQQSSGYSEDLNEIEY

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MAMDC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
52.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAMDC2 Protein

  • MAM domain containing 1
  • MAM domain containing 2
  • MAM domain-containing protein 2
  • MAM domain-containing proteoglycan
  • mamcan
  • MGC21981

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45511
Species: Hu
Applications: WB, IHC
NB100-98864
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-47271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31944
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27072
Species: Hu, Am, Bv, Ca, Eq, Op, Pm
Applications: WB, IHC-P
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF8125
Species: Hu, Mu
Applications: WB, Simple Western, IHC
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00000826-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
AF8105
Species: Hu
Applications: WB, IHC
NBP2-02483
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for MAMDC2 Recombinant Protein (H00256691-P01) (0)

There are no publications for MAMDC2 Recombinant Protein (H00256691-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAMDC2 Recombinant Protein (H00256691-P01) (0)

There are no reviews for MAMDC2 Recombinant Protein (H00256691-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAMDC2 Recombinant Protein (H00256691-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array H00256691-P01

Bioinformatics Tool for MAMDC2 Recombinant Protein (H00256691-P01)

Discover related pathways, diseases and genes to MAMDC2 Recombinant Protein (H00256691-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAMDC2 Recombinant Protein (H00256691-P01)

Discover more about diseases related to MAMDC2 Recombinant Protein (H00256691-P01).

Blogs on MAMDC2

There are no specific blogs for MAMDC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532
MAMDC2 Antibody
NBP1-81169

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAMDC2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAMDC2