MAMDC2 Antibody

Images

 
Western Blot: MAMDC2 Antibody [NBP1-81169] - Analysis in control (vector only transfected HEK293T lysate) and MAMDC2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: MAMDC2 Antibody [NBP1-81169] - Staining of human cell line U-2 OS shows localization to nuclear speckles & plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MAMDC2 Antibody [NBP1-81169] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: MAMDC2 Antibody [NBP1-81169] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: MAMDC2 Antibody [NBP1-81169] - Staining of human skin shows moderate positivity in plasma.
Immunohistochemistry-Paraffin: MAMDC2 Antibody [NBP1-81169] - Staining of human gastrointestinal shows moderate to strong cytoplasmic positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAMDC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FSPVHCQNQTELLFSAVEASCNFEQDLCNFYQDKEGPGWTRVKVKPNMYRAGDHTTGLGYYLLANTKFTSQPGYIGRLYGPSLPGNLQYCLRFHYAIY
Specificity
Specificity of human MAMDC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAMDC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAMDC2 Protein (NBP1-81169PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAMDC2 Antibody

  • MAM domain containing 1
  • MAM domain containing 2
  • MAM domain-containing protein 2
  • MAM domain-containing proteoglycan
  • mamcan
  • MGC21981

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45511
Species: Hu
Applications: WB, IHC
NB100-98864
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-469
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-920
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-27072
Species: Hu, Am, Bv, Ca, Eq, Ma-Op, Pm
Applications: WB, IHC, IHC-P, KD
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
AF8125
Species: Hu, Mu
Applications: WB, Simple Western, IHC
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-88606
Species: Hu
Applications: Simple Western, IHC, IHC-P
H00000826-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
AF8105
Species: Hu
Applications: WB, IHC
NBP2-02483
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-81169
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MAMDC2 Antibody (NBP1-81169) (0)

There are no publications for MAMDC2 Antibody (NBP1-81169).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAMDC2 Antibody (NBP1-81169) (0)

There are no reviews for MAMDC2 Antibody (NBP1-81169). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAMDC2 Antibody (NBP1-81169) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAMDC2 Products

Bioinformatics Tool for MAMDC2 Antibody (NBP1-81169)

Discover related pathways, diseases and genes to MAMDC2 Antibody (NBP1-81169). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAMDC2 Antibody (NBP1-81169)

Discover more about diseases related to MAMDC2 Antibody (NBP1-81169).

Blogs on MAMDC2

There are no specific blogs for MAMDC2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAMDC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAMDC2
Entrez