Home » MALT1 » MALT1 Proteins » Recombinant Human MALT1 GST (N-Term) Protein

Recombinant Human MALT1 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human MALT1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 685-784 of Human MALT1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EDTVEDKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCSRTPDAFISSFAHHAS
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MALT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MALT1 GST (N-Term) Protein

  • caspase-like protein
  • DKFZp434L132
  • EC 3.4.22.-
  • MALT associated translocation
  • MALT lymphoma-associated translocation
  • MALT1
  • MLT1
  • MLTMALT-lymphoma associated translocation
  • mucosa associated lymphoid tissue lymphoma translocation gene 1
  • mucosa-associated lymphoid tissue lymphoma translocation protein 1
  • Paracaspase

Background

MALT1 - mucosa associated lymphoid tissue lymphoma translocation gene 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Bcl-10 Antibody
(OTI4A8)
NBP2-02597
Flow Cytometry: Bcl10 Antibody (4A8) [NBP2-02597] - Analysis of Jurkat cells, using anti-Bcl10 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Western Blot: Bcl10 Antibody (4A8) [NBP2-02597] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Bcl10 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Bcl10.
Immunohistochemistry-Paraffin: Bcl10 Antibody (4A8) [NBP2-02597] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-Bcl10 mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on HeLa cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U2-OS cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(26 Reviews)
(342 Publications)
Species: Hu
Applications: BA
CARD11/CARMA1
Antibody (8N4C9)
NBP3-16849
Immunohistochemistry-Paraffin: CARD11/CARMA1 Antibody (8N4C9) [NBP3-16849] - Immunohistochemistry of paraffin-embedded rat spleen using CARD11/CARMA1 Rabbit mAb (NBP3-16849) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: CARD11/CARMA1 Antibody (8N4C9) [NBP3-16849] - Immunohistochemistry of paraffin-embedded mouse spleen using CARD11/CARMA1 Rabbit mAb (NBP3-16849) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry: CARD11/CARMA1 Antibody (8N4C9) [NBP3-16849] - Immunofluorescence analysis of rat spleen using CARD11/CARMA1 Rabbit mAb (NBP3-16849) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
cIAP-2/HIAP-1
Antibody - BSA Free
NBP1-27972
Immunocytochemistry/Immunofluorescence: cIAP-2/HIAP-1 Antibody [NBP1-27972] - HIAD1 staining in Hela cells detected with a Dylight 488 labeled secondary antibody (Green) with Hoechst 33258 nuclear counterstain (Blue).
Simple Western: cIAP-2/HIAP-1 Antibody [NBP1-27972] - Simple Western lane view shows a specific band for Ciap2 in 0.5 mg/ml of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. *Non-specific interaction with the 230 kDa standard may be seen with this antibody.
Immunohistochemistry: cIAP-2/HIAP-1 Antibody [NBP1-27972] - Analysis of human adenocarcinoma cells and adjacent glands using anti-cIAP2.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(718 Publications)
Species: Hu
Applications: BA
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - EA reduced MPP+-induced dopaminergic neuronal apoptosis by increasing BDNF (brain-derived neurotrophic factor) expression and further Akt phosphorylation in the rat substantia nigra. Eight days after MPP+ administration, our Western blot results (MAB7566) show that MPP+ treatment reduced tyrosine hydroxylase and Bcl-2 expression in the ipsilateral side of the rat substantia nigra (SN), but not in the contralateral side. EA stimulation (50 Hz) enhanced mature BDNF, tyrosine hydroxylase, and Bcl-2 expression in the MPP+-treated ipsilateral side. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/1422-0067/18/9/1846), licensed under a CC-BY licence.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 using this antibody at 1:2000, 20 ug/protein was loaded per lane. (1) Human Jurkat T cells. (2) Human RS11 lymphoma cells. (3-6) Human breast cancer cases. Patient sample in lane 5 lacked detectible Bcl-2 expression.
(2 Reviews)
(14 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Bcl-6 Antibody
NBP2-59786
Immunocytochemistry/Immunofluorescence: Bcl-6 Antibody [NBP2-59786] - Human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining in human tonsil and pancreas tissues . Corresponding BCL6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
A20/TNFAIP3
Antibody (59A426) - B ...
NBP1-77533
Flow Cytometry: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - An intracellular stain was performed on SK-MEL-28 cells with A20/TNFAIP3 (59A426) antibody NBP1-77533AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunocytochemistry/Immunofluorescence: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-A20/TNFAIP3 (59A426) at 10 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective
Flow Cytometry: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - An intracellular stain was performed on RH-30 cells with A20/TNFAIP3 Antibody (59A426) NBP1-77533PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(42 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
TRAF-2 Antibody
NB100-56173
Immunocytochemistry/Immunofluorescence: TRAF-2 Antibody [NB100-56173] - Immunostaining of HN30 and MCF-12a cells for TRAF2 3 days post-transfectionMCF-12a NT (DAPI): non-treated MCF-12a DAPI stained, MCF-12a NT (TRAF2-FITC): non-treated MCF-12a FITC stained for TRAF2, MCF-12a pNSP 5a3a (DAPI): MCF-12a transfected with pcDNA 3.0 NSP 5a3a DAPI stained, MCF-12a pNSP 5a3a (TRAF2-FITC): MCF-12a transfected with pcDNA 3.0 NSP 5a3a FITC stained for Traf-2, HN30 NT (DAPI): non-treated HN30 DAPI stained, HN30 NT (TRAF2-FITC): non-treated HN30 FITC stained for TRAF2, HN30 pNSP 5a3a (DAPI): HN30 transfected with pcDNA 3.0 NSP 5a3a DAPI stained, HN30 pNSP 5a3a (TRAF2-FITC): HN30 transfected with pcDNA 3.0 NSP 5a3a FITC stained for TRAF2. White arrows indicate apoptotic bodies. Image collected and cropped by Citeab from the following publication (A novel dual signaling axis for NSP 5a3a induced apoptosis in head and neck carcinoma. Oncotarget (2011) licensed under a CC-BY licence.
Immunohistochemistry: TRAF-2 Antibody [NB100-56173] - Formalin-fixed, paraffin-embedded human melanoma tissue section stained for TRAF2 at 1:2000. A1 is a higher magnification of A. Hematoxylin-eosin counterstain.
Immunohistochemistry-Paraffin: TRAF-2 Antibody [NB100-56173] - Formalin-fixed, paraffin-embedded human colon carcinoma tissue sections stained for TRAF2 using this antibody at 1:2000. Hematoxylin-eosin counterstain.
(3 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
TRAF-6 Inhibitor
Peptide Set
NBP2-26506
TRAF6 Inhibitor Peptide Set [NBP2-26506] - The TRAF6 inhibitory peptide inhibits osteoclast ifferentiation: RAW264.7 cells were plated on 24-well plates and stimulated with RANKL and M-CSF and incubated in the presence of different concentrations of control peptide (PTD) or the TRAF6. The TRAF6 at the concentration above 30 uM suppressed osteoclast differentiation.
(16 Publications)
Species: Hu, Mu, Rt
Applications: B/N, In vitro
Bcl-10 Antibody
(OTI4A8)
NBP2-02597
Flow Cytometry: Bcl10 Antibody (4A8) [NBP2-02597] - Analysis of Jurkat cells, using anti-Bcl10 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Western Blot: Bcl10 Antibody (4A8) [NBP2-02597] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Bcl10 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Bcl10.
Immunohistochemistry-Paraffin: Bcl10 Antibody (4A8) [NBP2-02597] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-Bcl10 mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CARD10 Antibody
NBP1-33042
Western Blot: CARD10 Antibody [NBP1-33042] - Mouse tissue extract (50 ug) was separated by 5% SDS-PAGE, and the membrane was blotted with CARD10 antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Immunohistochemistry-Paraffin: CARD10 Antibody [NBP1-33042] - Human breast carcinoma. CARD10 antibody [N2C1], Internal diluted at 1:250. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Prolactin Antibody
[Unconjugated]
AF682
Recombinant Human Prolactin (Catalog # 682-PL) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Prolactin (0.5 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682). The ND50 is typically 0.02-0.05 µg/mL.
Prolactin was detected in immersion fixed paraffin-embedded sections of human testis using Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682) at 1 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm of sperm cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human pituitary tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human Prolactin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF682) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Prolactin at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(6 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
IL-6 [HRP]
D6050
(32 Reviews)
(638 Publications)
Species: Hu
Applications: ELISA
DCTN3 Antibody
NBP1-52105
Immunohistochemistry-Paraffin: DCTN3 Antibody [NBP1-52105] - Staining (8ug/ml) of paraffin embedded Human Kidney. Heat induced antigen retrieval with citrate buffer pH 6, HRP-Staining.
Immunohistochemistry-Paraffin: DCTN3 Antibody [NBP1-52105] - Negative Control showing staining of paraffin embedded Human Kidney, with no primary antibody.
Western Blot: DCTN3 Antibody [NBP1-52105] - Staining (0.2ug/ml) of Mouse (A) and Rat (B) Skeletal Muscle lysates (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB

Calcium-binding-protei
NBP1-33736
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded SW480 xenograft, using antibody at 1:100 dilution.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
DYNC1H1 Antibody
NBP1-84254
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining in human cerebral cortex and pancreas tissues using anti-DYNC1H1 antibody. Corresponding DYNC1H1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Prohibitin 2
Antibody
NBP2-13754
Immunocytochemistry/Immunofluorescence: Prohibitin 2 Antibody [NBP2-13754] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Prohibitin 2 Antibody [NBP2-13754] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Prohibitin 2 Antibody [NBP2-13754] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on Jurkat cells with c-Myc Antibody (9E10) NB600-302R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
(4 Reviews)
(38 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB

Publications for MALT1 Partial Recombinant Protein (H00010892-Q01) (0)

There are no publications for MALT1 Partial Recombinant Protein (H00010892-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MALT1 Partial Recombinant Protein (H00010892-Q01) (0)

There are no reviews for MALT1 Partial Recombinant Protein (H00010892-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MALT1 Partial Recombinant Protein (H00010892-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MALT1 Products

Bioinformatics Tool for MALT1 Partial Recombinant Protein (H00010892-Q01)

Discover related pathways, diseases and genes to MALT1 Partial Recombinant Protein (H00010892-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MALT1 Partial Recombinant Protein (H00010892-Q01)

Discover more about diseases related to MALT1 Partial Recombinant Protein (H00010892-Q01).
 

Pathways for MALT1 Partial Recombinant Protein (H00010892-Q01)

View related products by pathway.

PTMs for MALT1 Partial Recombinant Protein (H00010892-Q01)

Learn more about PTMs related to MALT1 Partial Recombinant Protein (H00010892-Q01).
 

Research Areas for MALT1 Partial Recombinant Protein (H00010892-Q01)

Find related products by research area.

Blogs on MALT1

There are no specific blogs for MALT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Recombinant Human MALT1 Protein [H00010892-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human MALT1 GST (N-Term) Protein
H00010892-P01-10ug
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
IL-6 [HRP]
IL-6 [HRP]
D6050

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MALT1 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol MALT1