Recombinant Human MAL Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MAL Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 153 of Human MAL full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS

Protein/Peptide Type
Recombinant Protein
Gene
MAL

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAL Protein

  • mal, T-cell differentiation protein
  • myelin and lymphocyte protein
  • T-cell differentiation protein MAL
  • T-lymphocyte maturation-associated protein

Background

The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Alternative splicing produces four transcript variants which vary from each other by the presence or absence of alternatively spliced exons 2 and 3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4348
Species: Hu, Mu, Rt
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3646
Species: Hu
Applications: WB, ICC
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-27184
Species: Hu, Mu, Ca, Eq
Applications: WB, ICC/IF
NBL1-12830
Species: Hu
H00004118-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for MAL Recombinant Protein (H00004118-P01) (0)

There are no publications for MAL Recombinant Protein (H00004118-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAL Recombinant Protein (H00004118-P01) (0)

There are no reviews for MAL Recombinant Protein (H00004118-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAL Recombinant Protein (H00004118-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAL Products

Bioinformatics Tool for MAL Recombinant Protein (H00004118-P01)

Discover related pathways, diseases and genes to MAL Recombinant Protein (H00004118-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAL Recombinant Protein (H00004118-P01)

Discover more about diseases related to MAL Recombinant Protein (H00004118-P01).
 

Pathways for MAL Recombinant Protein (H00004118-P01)

View related products by pathway.

PTMs for MAL Recombinant Protein (H00004118-P01)

Learn more about PTMs related to MAL Recombinant Protein (H00004118-P01).
 

Research Areas for MAL Recombinant Protein (H00004118-P01)

Find related products by research area.

Blogs on MAL

There are no specific blogs for MAL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MAL Antibody
NBP2-22522

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAL Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAL