MAK16 Antibody - BSA Free

Western Blot: MAK16 Antibody [NBP2-87772] - Host: Rabbit. Target Name: MAK16. Sample Tissue: Human HepG2 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MAK16 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAK16. Peptide sequence: AIEKELLERLKQDTYGDIYNFPIHAFDKALEQQEAESDSSDTEEKDDDDD The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAK16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MAK16 Antibody - BSA Free

• MAK16 homolog (S. cerevisiae)
• MAK16L
• NNP78
• protein MAK16 homolog
• Protein RBM13
• RBM13
• RNA binding motif protein 13
• RNA binding protein

Background

RBM13 (RNA-binding motif protein 13) is a member of the MAK16 (maintenance of killer protein 16) family of proteins. Despite its name, RBM13 has not been shown to be an RNA-binding protein, and the function of RBM13 is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAK16