MAGT1 Antibody - BSA Free

Western Blot: MAGT1 Antibody [NBP1-69683] - This Anti-RP11-217H1.1 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

Western Blot: MAGT1 Antibody [NBP1-69683] - PANC1, Antibody Dilution: 1.0 ug/ml MAGT1 is supported by BioGPS gene expression data to be expressed in PANC1.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MAGT1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RP11-217H1.1 The peptide sequence was selected from the N terminal of RP11-217H1.1 (NP_115497). Peptide sequence ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAGT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MAGT1 Antibody - BSA Free

• bA217H1.1
• DKFZp564K142
• FLJ14726
• IAG2
• IAPPRO0756
• Implantation-associated protein
• magnesium transporter 1
• magnesium transporter protein 1
• MagT1
• MGC64926
• MRX95
• oligosaccharyltransferase 3 homolog B
• OST3B

Background

The specific function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MAGT1 Antibody (NBP1-69683)(2)

Publications using NBP1-69683

• Wang L, Tang Y, Wu H, Shan G. TCF12 activates MAGT1 expression to regulate the malignant progression of pancreatic carcinoma cells Oncology Letters 2021-12-27 [PMID: 35069871]
• Shibatani,T. Biochemistry 44 (16), 5982-5992. 2005-01-01 [PMID: 15835887]

Bioinformatics

• Gene Symbol: MAGT1
• Entrez:
  • 84061(Human)
  • 116967(Rat)
• Uniprot:
  • B4DH58(Human)