MAGT1 Antibody


Western Blot: MAGT1 Antibody [NBP1-69683] - This Anti-RP11-217H1.1 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.
Western Blot: MAGT1 Antibody [NBP1-69683] - PANC1, Antibody Dilution: 1.0 ug/ml MAGT1 is supported by BioGPS gene expression data to be expressed in PANC1.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MAGT1 Antibody Summary

Synthetic peptides corresponding to RP11-217H1.1 The peptide sequence was selected from the N terminal of RP11-217H1.1 (NP_115497). Peptide sequence ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RP11-217H1.1 and was validated on Western blot.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
MAGT1 Lysate (NBP2-65092)
Read Publication using NBP1-69683.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAGT1 Antibody

  • bA217H1.1
  • DKFZp564K142
  • FLJ14726
  • IAG2
  • IAPPRO0756
  • Implantation-associated protein
  • magnesium transporter 1
  • magnesium transporter protein 1
  • MagT1
  • MGC64926
  • MRX95
  • oligosaccharyltransferase 3 homolog B
  • OST3B


The specific function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS, ICC
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu
Applications: WB, IHC, KO
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for MAGT1 Antibody (NBP1-69683)(1)

Showing Publication 1 - 1 of 1.
Publication using NBP1-69683 Applications Species
Shibatani,T. Biochemistry 44 (16), 5982-5992. 2005 [PMID: 15835887]

Reviews for MAGT1 Antibody (NBP1-69683) (0)

There are no reviews for MAGT1 Antibody (NBP1-69683). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGT1 Antibody (NBP1-69683) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MAGT1 Antibody and receive a gift card or discount.


Gene Symbol MAGT1