Western Blot: MAGEA3 Antibody [NBP1-56404] - This Anti-MAGEA3 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: MAGEA3 Antibody [NBP1-56404] - Human testis tissue at an antibody concentration of 4-8ug/ml.
Synthetic peptides corresponding to MAGEA3(melanoma antigen family A, 3) The peptide sequence was selected from the middle region of MAGEA3. Peptide sequence APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for MAGEA3 Antibody
Antigen MZ2-D
Cancer/testis antigen 1.3
CT1.3 MAGE-3 antigen
CT1.3
HIP8
MAGE3 MAGEA6
MAGE3
MAGEA3
melanoma antigen family A, 3
melanoma-associated antigen 3
member 3
MGC14613
Background
MAGEA3 is a member of the MAGEA family. The members of this family have 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for MAGEA3 Antibody (NBP1-56404)
Discover related pathways, diseases and genes to MAGEA3 Antibody (NBP1-56404). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for MAGEA3 Antibody (NBP1-56404)
Discover more about diseases related to MAGEA3 Antibody (NBP1-56404).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our MAGEA3 Antibody and receive a gift card or discount.