MAGEA3 Antibody

Western Blot: MAGEA3 Antibody [NBP1-56404] - This Anti-MAGEA3 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.

Immunohistochemistry-Paraffin: MAGEA3 Antibody [NBP1-56404] - Human testis tissue at an antibody concentration of 4-8ug/ml.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MAGEA3 Antibody Summary

• Immunogen: Synthetic peptides corresponding to MAGEA3(melanoma antigen family A, 3) The peptide sequence was selected from the middle region of MAGEA3. Peptide sequence APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAGEA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 4-8 ug/ml
  • Immunohistochemistry-Paraffin 4-8 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against MAGEA3 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAGEA3 Antibody

• Antigen MZ2-D
• Cancer/testis antigen 1.3
• CT1.3 MAGE-3 antigen
• CT1.3
• HIP8
• MAGE3 MAGEA6
• MAGE3
• MAGEA3
• melanoma antigen family A, 3
• melanoma-associated antigen 3
• member 3
• MGC14613

Background

MAGEA3 is a member of the MAGEA family. The members of this family have 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MAGEA3 Antibody (NBP1-56404)(1)

Publication using NBP1-56404

• Abad Sebastien, Wieers Gregoire, Colau Didier et al. Absence of recognition of common melanocytic antigens by T cells isolated from the cerebrospinal fluid of a Vogt-Koyanagi-Harada patient. Mol Vis. 2014 Jul 02 [PMID: 24991188] (WB)

Bioinformatics

• Gene Symbol: MAGEA3
• Uniprot:
  • P43357(Human)