MAGEA3 Antibody

Images

 
Western Blot: MAGEA3 Antibody [NBP1-56404] - This Anti-MAGEA3 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: MAGEA3 Antibody [NBP1-56404] - Human testis tissue at an antibody concentration of 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAGEA3 Antibody Summary

Immunogen
Synthetic peptides corresponding to MAGEA3(melanoma antigen family A, 3) The peptide sequence was selected from the middle region of MAGEA3. Peptide sequence APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 4-8 ug/ml
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MAGEA3 and was validated on Western blot.
Publications
Read Publication using NBP1-56404.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MAGEA3 Antibody

  • Antigen MZ2-D
  • Cancer/testis antigen 1.3
  • CT1.3 MAGE-3 antigen
  • CT1.3
  • HIP8
  • MAGE3 MAGEA6
  • MAGE3
  • MAGEA3
  • melanoma antigen family A, 3
  • melanoma-associated antigen 3
  • member 3
  • MGC14613

Background

MAGEA3 is a member of the MAGEA family. The members of this family have 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-47714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67233
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-41318
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, ICC, IF
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-62688
Species: Hu
Applications: IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB100-64775
Species: Hu, Mu, Pm, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, CyTOF-ready, IHC-P (-)
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-54704
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85397
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45722
Species: Hu
Applications: WB, IHC
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-56404
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MAGEA3 Antibody (NBP1-56404)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for MAGEA3 Antibody (NBP1-56404) (0)

There are no reviews for MAGEA3 Antibody (NBP1-56404). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGEA3 Antibody (NBP1-56404) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAGEA3 Products

Bioinformatics Tool for MAGEA3 Antibody (NBP1-56404)

Discover related pathways, diseases and genes to MAGEA3 Antibody (NBP1-56404). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEA3 Antibody (NBP1-56404)

Discover more about diseases related to MAGEA3 Antibody (NBP1-56404).
 

Pathways for MAGEA3 Antibody (NBP1-56404)

View related products by pathway.

PTMs for MAGEA3 Antibody (NBP1-56404)

Learn more about PTMs related to MAGEA3 Antibody (NBP1-56404).
 

Research Areas for MAGEA3 Antibody (NBP1-56404)

Find related products by research area.

Blogs on MAGEA3

There are no specific blogs for MAGEA3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEA3
Uniprot