GAGE1 Antibody

Images

 
Western Blot: GAGE1 Antibody [NBP2-54704] - Analysis in human cell line AN3-CA.
Immunohistochemistry-Paraffin: GAGE1 Antibody [NBP2-54704] - Staining of human colon shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: GAGE1 Antibody [NBP2-54704] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferious ducts.
Immunohistochemistry-Paraffin: GAGE1 Antibody [NBP2-54704] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: GAGE1 Antibody [NBP2-54704] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GAGE1 Antibody Summary

Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids: PPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAGE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GAGE1 Recombinant Protein Antigen (NBP2-54704PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GAGE1 Antibody

  • Antigen MZ2-F
  • Cancer/testis antigen 4.1
  • G antigen 1
  • GAGE-1
  • member 1
  • MGC33825
  • MZ2-F antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34754
Species: Ca, Hu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P
NBP1-98298
Species: Hu
Applications: WB
H00004102-M01
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-42913
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-62688
Species: Hu
Applications: IHC, IHC-P
NBP2-41318
Species: Hu, Mu, Rt
Applications: ELISA, ICC, IF, IHC, IHC-P, WB
NBP2-14921
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-30151
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89062
Species: Hu
Applications: IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP3-09603
Species: Hu
Applications: WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-54704
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GAGE1 Antibody (NBP2-54704) (0)

There are no publications for GAGE1 Antibody (NBP2-54704).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAGE1 Antibody (NBP2-54704) (0)

There are no reviews for GAGE1 Antibody (NBP2-54704). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAGE1 Antibody (NBP2-54704) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAGE1 Products

Bioinformatics Tool for GAGE1 Antibody (NBP2-54704)

Discover related pathways, diseases and genes to GAGE1 Antibody (NBP2-54704). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAGE1 Antibody (NBP2-54704)

Discover more about diseases related to GAGE1 Antibody (NBP2-54704).
 

Pathways for GAGE1 Antibody (NBP2-54704)

View related products by pathway.

PTMs for GAGE1 Antibody (NBP2-54704)

Learn more about PTMs related to GAGE1 Antibody (NBP2-54704).
 

Research Areas for GAGE1 Antibody (NBP2-54704)

Find related products by research area.

Blogs on GAGE1

There are no specific blogs for GAGE1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAGE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAGE1